DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DAPK3 and sqa

DIOPT Version :9

Sequence 1:NP_001339.1 Gene:DAPK3 / 1613 HGNCID:2676 Length:454 Species:Homo sapiens
Sequence 2:NP_001260832.1 Gene:sqa / 36002 FlyBaseID:FBgn0259678 Length:888 Species:Drosophila melanogaster


Alignment Length:411 Identity:137/411 - (33%)
Similarity:209/411 - (50%) Gaps:68/411 - (16%)


- Green bases have known domain annotations that are detailed below.


Human     5 RQEDVEDHYEMGEELGSGQFAIVRKCRQKGTGKEYAAKF--IKKRRLSSSRRGVSREEIEREVNI 67
            |..|...||::..|:|.|:|..|.|||.|..|.:.||||  |.||.        .:..:||||.|
  Fly    26 RNVDAHKHYDVLGEVGRGKFGTVYKCRDKANGLQLAAKFVPIPKRE--------DKRNVEREVEI 82

Human    68 LREIRHPNIITLHDIFENKTDVVLILELVSGGELFDFLAEKE-SLTEDEATQFLKQILDGVHYLH 131
            :..::|..||.|:..:|.:..:.::|||:.||||||.:.:.| .|||.....|::|:.:.:.::|
  Fly    83 MNSLQHHLIIQLYAAYEYQKMMCVVLELIEGGELFDRVVDDEFVLTERVCRVFIRQVCEAMAFIH 147

Human   132 SKRIAHFDLKPENIMLLDKNVPNPRIKLIDFGIAHKIEAGNEFKNIFGTPEFVAPEIVNYEPLGL 196
            ...|.|.|||||||::|.:.  ..|||:||||:|.|.:.....:.:||||||||||:||::.:..
  Fly   148 GNGIVHLDLKPENILVLTQK--GNRIKIIDFGLARKFDPDKRLRVLFGTPEFVAPEVVNFDCISY 210

Human   197 EADMWSIGVITYILLSGASPFLGETKQETLTNISAVNYDFDEEYFSNTSELAKDFIRRLLVKDPK 261
            ..||||:|||.|:|:||.|||:||...||::|::...|||::|.|:..|....|||.:||.||..
  Fly   211 GTDMWSVGVICYVLISGLSPFMGENDIETMSNVTIAKYDFEDECFNGISPECLDFIAKLLAKDLS 275

Human   262 RRMTIAQSLEHSWIKAIRRRNVRGEDSGRKPERRRLKTTRLKEYTIKSHSSLPPNNSYADFERFS 326
            .|||.|:.::|.|::             ::|......|...|..:..|.|.|         :..|
  Fly   276 TRMTAAECMKHKWLQ-------------QRPATAATATPITKAASAASKSRL---------KSVS 318

Human   327 KVLEEAAAAEEGLRELQRSRRLCHEDVEALAAIYEEKEAWYREESDSLGQDLRRLRQELLKTEAL 391
            .|...:.::|:....::      .||.|...|:.:.|:                           
  Fly   319 PVTAPSESSEDSTETIE------DEDDEEEVAVQQAKQ--------------------------- 350

Human   392 KRQAQEEAKGALLGTSGLKRR 412
            |.|.|:|....|.|.:.|:.:
  Fly   351 KDQQQDEELANLCGDAELENK 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DAPK3NP_001339.1 STKc_DAPK 7..275 CDD:271007 114/270 (42%)
Activation segment. /evidence=ECO:0000250|UniProtKB:O96017 161..204 21/42 (50%)
Leucine-zipper. /evidence=ECO:0000303|PubMed:9488481 427..441
sqaNP_001260832.1 S_TKc 34..289 CDD:214567 112/264 (42%)
STKc_MLCK 40..289 CDD:271005 110/258 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.