DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment REM2 and rem2

DIOPT Version :9

Sequence 1:XP_016876547.1 Gene:REM2 / 161253 HGNCID:20248 Length:373 Species:Homo sapiens
Sequence 2:XP_002941555.1 Gene:rem2 / 100488324 XenbaseID:XB-GENE-491229 Length:292 Species:Xenopus tropicalis


Alignment Length:306 Identity:180/306 - (58%)
Similarity:221/306 - (72%) Gaps:21/306 - (6%)


- Green bases have known domain annotations that are detailed below.


Human    73 LKKSEKLLA-ELDRSGLPSAPGAPRRRGSMPVPYKHQLRRAQAVDELDWPPQASSSGSSDSLGSG 136
            |.|.|||.. :..|..||.:.| ||||||||:||||||||.|||||||||  :..||||||:.|.
 Frog     3 LNKKEKLGGLQQHRGSLPLSSG-PRRRGSMPLPYKHQLRRTQAVDELDWP--SVHSGSSDSIRSS 64

Human   137 EAAPAQKDGIFKVMLVGESGVGKSTLAGTFGGLQGDSAHEPENPAEDTYERRIMVDKEEVTLVVY 201
            |::|  ..|::||||:|:||||||||||.|||::....|..|:| ||||||.::||.|:.||:||
 Frog    65 ESSP--DTGVYKVMLLGDSGVGKSTLAGIFGGVEDTFPHGSEHP-EDTYERNLLVDGEKTTLIVY 126

Human   202 DIWEQGDAGGWLRDHCLQTGDAFLIVFSVTDRRSFSKVPETLLRLRAGRPHHDLPVILVGNKSDL 266
            ||||:..:..|::|.|||.|||||::||||||.:|.::|..||:||..|||..:|:||||||.||
 Frog   127 DIWEEAGSQSWMQDSCLQMGDAFLLIFSVTDRSTFQRLPSLLLQLRTARPHRHIPIILVGNKGDL 191

Human   267 ARSREVSLEEGRHLAGTLSCKHIETSAALHHNTRELFEGAVRQIRLRRGRNHAGGQRPDPGSPEG 331
            .|||||::||||.|||.|:||:.|.||||||||.||.||.|||||||:          |.|....
 Frog   192 VRSREVNMEEGRSLAGMLNCKYTEISAALHHNTHELLEGVVRQIRLRK----------DEGEHSL 246

Human   332 PAP----PARRESLTKKAKRFLANLVPRNAKFFKQRSRSCHDLSVL 373
            ..|    |.|||||||:|:|.|..|:.::..||||||:||||||||
 Frog   247 QTPILLTPGRRESLTKRARRLLQGLMGKHRGFFKQRSKSCHDLSVL 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
REM2XP_016876547.1 None
rem2XP_002941555.1 RGK 73..292 CDD:206715 134/229 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 225 1.000 Domainoid score I13391
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H11222
Inparanoid 1 1.050 348 1.000 Inparanoid score I9876
NCBI 1 1.000 - -
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D254353at32523
OrthoFinder 1 1.000 - - FOG0013427
OrthoInspector 1 1.000 - - oto151496
Panther 1 1.100 - - LDO PTHR45775
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R11395
SonicParanoid 1 1.000 - - X743
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1212.100

Return to query results.
Submit another query.