DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DAPK1 and CG10126

DIOPT Version :9

Sequence 1:NP_001275658.1 Gene:DAPK1 / 1612 HGNCID:2674 Length:1430 Species:Homo sapiens
Sequence 2:NP_788664.2 Gene:CG10126 / 41579 FlyBaseID:FBgn0038088 Length:227 Species:Drosophila melanogaster


Alignment Length:133 Identity:27/133 - (20%)
Similarity:43/133 - (32%) Gaps:47/133 - (35%)


- Green bases have known domain annotations that are detailed below.


Human   626 VRYLCL---------MGASVEALTTDGKTAEDLARSEQHEHVAGLLARLRKDTHRGLFIQQLRPT 681
            :|.|||         :|.:..|:..||..|     ..:.|.:.|:     :||  ||.:.:....
  Fly    47 LRLLCLSRGATGILGLGRAFRAMDDDGSKA-----LNEEEFITGI-----RDT--GLDVSEEEIK 99

Human   682 QNLQPRIKLKLFGHSGSGKTTLVESLKCGLLRSFFRRRRPRLSSTNSSRFPPSPLASKPTVSVSI 746
            |      ....|...|||...:.|         |..:.|           ||.|.:....:..:.
  Fly   100 Q------MFATFDEDGSGSINMTE---------FLLKLR-----------PPMPQSRLNIIDQAF 138

Human   747 NNL 749
            |.:
  Fly   139 NKM 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DAPK1NP_001275658.1 STKc_DAPK1 7..275 CDD:271096
Calmodulin-binding 267..334
Autoinhibitory domain. /evidence=ECO:0000250 292..301
ANK 373..497 CDD:238125
ANK repeat 378..409 CDD:293786
ANK 1 378..407
ANK 2 411..440
ANK repeat 412..442 CDD:293786
ANK 439..564 CDD:238125
ANK repeat 444..475 CDD:293786
ANK 3 444..473
ANK repeat 477..508 CDD:293786
ANK 4 477..506
ANK 505..629 CDD:238125 1/2 (50%)
ANK repeat 510..541 CDD:293786
ANK 5 510..539
Ank_2 <515..768 CDD:330894 27/133 (20%)
ANK repeat 543..574 CDD:293786
ANK 6 543..572
ANK repeat 576..607 CDD:293786
ANK 7 576..605
ANK repeat 609..638 CDD:293786 5/20 (25%)
ANK 8 609..638 5/20 (25%)
ANK 9 875..904
ANK 10 1162..1196
Death_DAPK1 1308..1393 CDD:260052
CG10126NP_788664.2 EF-hand_7 62..119 CDD:290234 17/83 (20%)
EFh 64..119 CDD:238008 16/81 (20%)
EFh 97..154 CDD:238008 12/71 (17%)
EF-hand_7 98..158 CDD:290234 12/70 (17%)
EF-hand_7 134..204 CDD:290234 1/8 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.