DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DAPK1 and sqa

DIOPT Version :9

Sequence 1:NP_001275658.1 Gene:DAPK1 / 1612 HGNCID:2674 Length:1430 Species:Homo sapiens
Sequence 2:NP_001260832.1 Gene:sqa / 36002 FlyBaseID:FBgn0259678 Length:888 Species:Drosophila melanogaster


Alignment Length:893 Identity:230/893 - (25%)
Similarity:353/893 - (39%) Gaps:223/893 - (24%)


- Green bases have known domain annotations that are detailed below.


Human     1 MTVFRQENVDDYYDTGEELGSGQFAVVKKCREKSTGLQYAAKF--IKKRRTKSSRRGVSREDIER 63
            :|:.|..:...:||...|:|.|:|..|.|||:|:.|||.||||  |.||..|        .::||
  Fly    22 VTINRNVDAHKHYDVLGEVGRGKFGTVYKCRDKANGLQLAAKFVPIPKREDK--------RNVER 78

Human    64 EVSILKEIQHPNVITLHEVYENKTDVILILELVAGGELFDFLAEKE-SLTEEEATEFLKQILNGV 127
            ||.|:..:||..:|.|:..||.:..:.::|||:.||||||.:.:.| .|||.....|::|:...:
  Fly    79 EVEIMNSLQHHLIIQLYAAYEYQKMMCVVLELIEGGELFDRVVDDEFVLTERVCRVFIRQVCEAM 143

Human   128 YYLHSLQIAHFDLKPENIMLLDRNVPKPRIKIIDFGLAHKIDFGNEFKNIFGTPEFVAPEIVNYE 192
            .::|...|.|.|||||||::|.:.  ..||||||||||.|.|.....:.:||||||||||:||::
  Fly   144 AFIHGNGIVHLDLKPENILVLTQK--GNRIKIIDFGLARKFDPDKRLRVLFGTPEFVAPEVVNFD 206

Human   193 PLGLEADMWSIGVITYILLSGASPFLGDTKQETLANVSAVNYEFEDEYFSNTSALAKDFIRRLLV 257
            .:....||||:|||.|:|:||.|||:|:...||::||:...|:||||.|:..|....|||.:||.
  Fly   207 CISYGTDMWSVGVICYVLISGLSPFMGENDIETMSNVTIAKYDFEDECFNGISPECLDFIAKLLA 271

Human   258 KDPKKRMTIQDSLQHPWIKPKD----TQQALSRKASAVNMEKFKKF------------------- 299
            ||...|||..:.::|.|::.:.    |...:::.|||.:..:.|..                   
  Fly   272 KDLSTRMTAAECMKHKWLQQRPATAATATPITKAASAASKSRLKSVSPVTAPSESSEDSTETIED 336

Human   300 -----------AARKKWKQSVRLISLCQRLSRSFLSRSNMSVARSDDTLDEEDSFVMKAIIHAIN 353
                       |.:|..:|...|.:||        ..:.:.....|.|.|...:|:::...|. |
  Fly   337 EDDEEEVAVQQAKQKDQQQDEELANLC--------GDAELENKELDATKDNLKNFIVRWETHP-N 392

Human   354 DDNVPGLQ-HLLGSLSNYDVNQPNK-HGTPPLLIA-----AGCGNIQILQLLIKRGSRIDVQDKG 411
            ...|..:: :::..||......|.: ||...|..:     :.|.:|..| ...:||...|:.::.
  Fly   393 SPYVFDVEGNVIAPLSETSYPHPRRTHGADSLSSSRVCSPSPCDSISTL-TDDERGDIEDLPEED 456

Human   412 GSNAVYWAARHGHVDTLKFLSENKCPLDVK---DKSGEMALHVAARYGHADVAQLLCSFGSNPNI 473
            .|.:                :||:.|..|.   ::|.|......|.              |:|: 
  Fly   457 ESRS----------------AENESPRSVATPINESREKLFPTVAT--------------SSPS- 490

Human   474 QDKEEETPLHCAAWHGYYSVAKALCEAGCNVNIKNREG--ETPLLTASARGYHDIVECLAEHGAD 536
                ..||.|.                 .|.|.....|  .|.....|.:.|             
  Fly   491 ----TPTPQHL-----------------FNENFDEFSGSQSTAQQQRSMKSY------------- 521

Human   537 LNACDKDGHIALHLAVRRCQMEVIKTLLSQGCFVDYQDRHGNTPLHVACKDGNMPIVVALCEANC 601
            |:..|:......:|..||          |.|..|:..|.......|          ::.|.|.|.
  Fly   522 LHTFDRRNSDTTYLLGRR----------SSGERVNLADEIRKLSDH----------LLMLAEINT 566

Human   602 NLDISNKYGRTPLHLAANNGILDVVRYLCLMGASVEALT----------TDGKTAEDLARSEQHE 656
            .|..:|..|      :::....|.........|.|...|          |..||:|......:..
  Fly   567 KLGDANNNG------SSSGAPADPPAAAAAAAAPVPTSTAPASVAPSGSTSSKTSEISQEGNRWT 625

Human   657 HVAGLLARLRKDTHR-GLFIQ-----------------------QLRPTQNLQPRIKLKLFGHSG 697
            ......:...:.|.: |||.|                       .:|..|:::...||. .|:|.
  Fly   626 SKTTSSSSWNRPTLKGGLFSQASSSSQSQSTYDDGKGKTKISSLSVRLQQSIEETPKLS-NGNSS 689

Human   698 SGKT-------TLVESLKCGLLRSFFRRRRPRLSSTNSSRFPP---------------------S 734
            |.|:       :.|:::.....|||..::..|.|:|:|.....                     |
  Fly   690 SSKSLVQSQRKSTVQTMSSSNARSFTNQQVQRTSTTSSKVISSSTRSSNTSSSNYIASNASNSIS 754

Human   735 PLASKPTVSVSINNLYPGCENVSVRSRSMMFEPGLTKGMLEVFVAPTH 782
            ..||.|:.:.:.|.:.....|.|..||...|........:.|.:..||
  Fly   755 TSASNPSSTGASNPITTSASNESASSRRAKFRINQMSRDVPVGLPDTH 802

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DAPK1NP_001275658.1 STKc_DAPK1 7..275 CDD:271096 120/270 (44%)
Calmodulin-binding 267..334 13/100 (13%)
Autoinhibitory domain. /evidence=ECO:0000250 292..301 1/38 (3%)
ANK 373..497 CDD:238125 23/132 (17%)
ANK repeat 378..409 CDD:293786 9/35 (26%)
ANK 1 378..407 8/33 (24%)
ANK 2 411..440 4/28 (14%)
ANK repeat 412..442 CDD:293786 5/32 (16%)
ANK 439..564 CDD:238125 20/129 (16%)
ANK repeat 444..475 CDD:293786 5/30 (17%)
ANK 3 444..473 5/28 (18%)
ANK repeat 477..508 CDD:293786 5/30 (17%)
ANK 4 477..506 4/28 (14%)
ANK 505..629 CDD:238125 22/125 (18%)
ANK repeat 510..541 CDD:293786 5/32 (16%)
ANK 5 510..539 5/30 (17%)
Ank_2 <515..768 CDD:330894 57/314 (18%)
ANK repeat 543..574 CDD:293786 6/30 (20%)
ANK 6 543..572 6/28 (21%)
ANK repeat 576..607 CDD:293786 5/30 (17%)
ANK 7 576..605 5/28 (18%)
ANK repeat 609..638 CDD:293786 4/28 (14%)
ANK 8 609..638 4/28 (14%)
ANK 9 875..904
ANK 10 1162..1196
Death_DAPK1 1308..1393 CDD:260052
sqaNP_001260832.1 S_TKc 34..289 CDD:214567 120/264 (45%)
STKc_MLCK 40..289 CDD:271005 117/258 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.