DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DAPK1 and Unc-89

DIOPT Version :9

Sequence 1:NP_001275658.1 Gene:DAPK1 / 1612 HGNCID:2674 Length:1430 Species:Homo sapiens
Sequence 2:NP_001097440.1 Gene:Unc-89 / 3346201 FlyBaseID:FBgn0053519 Length:4218 Species:Drosophila melanogaster


Alignment Length:803 Identity:188/803 - (23%)
Similarity:306/803 - (38%) Gaps:222/803 - (27%)


- Green bases have known domain annotations that are detailed below.


Human     1 MTVFRQENVDDY---------------------YDTGEELGSGQFAVVKKCREKSTGLQYAAKFI 44
            :||..:||.|.|                     ||.|:|||.|...:.....|:|:|..||||.:
  Fly  3153 VTVHIEENEDQYIYKTYGRHPYVRSKQLRYQDKYDIGDELGRGTQGITYHAVERSSGDNYAAKIM 3217

Human    45 KKRRTKSSRRGVSREDIEREVSILKEIQHPNVITLHEVYENKTDVILILELVAGGELF-DFLAEK 108
            ..|..       .|..:..|:.::....|.|:|..::.|:....|.||:||.|||||. |.|..:
  Fly  3218 YGRPE-------LRPFMLNELEMMNTFNHKNLIRPYDAYDTDRSVTLIMELAAGGELVRDNLLRR 3275

Human   109 ESLTEEEATEFLKQILNGVYYLHSLQIAHFDLKPENIMLLDRNVPKPRIKIIDFGLAHKIDFGNE 173
            :..||.:...:::|.|.|:.::|.:.:.|..|..:::::  ..|....||:.||||:.||:..|.
  Fly  3276 DYYTERDIAHYIRQTLWGLEHMHEMGVGHMGLTIKDLLI--SVVGGDIIKVSDFGLSRKINRHNL 3338

Human   174 FKNIFGTPEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGDTKQETLANVSAVNYEFED 238
            ....:|.||||:||:||.|.:....|||::|:|||:||.|.:||||...:|||..:....::|:|
  Fly  3339 STLDYGMPEFVSPEVVNKEGVNFSHDMWTVGLITYVLLGGHNPFLGIDDRETLTKIREGRWDFKD 3403

Human   239 EYFSNTSALAKDFIRRLLVKDPKKRMTIQDSLQHPW-------IKPKDTQQALSRKASAVNMEKF 296
            |.:::.|...:|||.|||:..|::||.::.:|:|||       :...|.|....|..:  ..:.|
  Fly  3404 EIWTHISDDGRDFISRLLLYSPEERMDVKTALKHPWFFMLDRPVYDHDYQIGTDRLRN--YYDHF 3466

Human   297 KKFAARKKWKQSVRLISLCQRLSRSFLSRSNM-----SVARSDDTLDEEDSFVMKAIIHAINDDN 356
            :.:.|....|...|.    :|||..|...|.|     .|...::|.:.    :.:..|.|..::.
  Fly  3467 RDWYANASCKNYFRR----RRLSGCFQHPSKMVYPPGHVYTPENTPEP----LPEPRIRAKREEV 3523

Human   357 VPGLQH------LLGSLSNYDVNQPNKHGTPPLLIAAGCGNIQI-----LQLLIKRGSRIDVQDK 410
            |....|      |:.|.|:|      ::|....|:.....|..:     :::..:|.....:.| 
  Fly  3524 VSKYLHPDYELGLIQSESHY------QYGPDTYLLQLRDVNFPVRLREYMKVAHRRSPSFALND- 3581

Human   411 GGSNAVYWAARHGHVDTLKFLSENKCPLDVKDKSGEMALHVAARYGHADVAQLLCSFGSNPNIQD 475
                :|.|        :|..:.|.:...|:.|:                            .|.|
  Fly  3582 ----SVDW--------SLPVIRERRRFTDIMDE----------------------------EIDD 3606

Human   476 KEEETPLHCAAWHGYYSVAKALCEAGCNVN---------IKNREG------ETPLLTASARGYHD 525
            :...:.:...|.:..||:.:...|.|..::         ...|||      |.|...|.......
  Fly  3607 ERTRSRISMYAANESYSIRRLRTELGPRLDEYTEADAMIETQREGYPPFFREKPQTIAITENQPS 3671

Human   526 IVECLAEHGADLNAC--------------------DKDGHI------ALHL-------------- 550
            .:.|.|.  .|...|                    |:||..      |||.              
  Fly  3672 HIHCFAV--GDPKPCVQWFKNDMVLTESKRIKISVDEDGRSILRFEPALHFDVGVYKVVARNKVG 3734

Human   551 -AVRRCQMEVIKTLLSQGCFVDYQDRHGNTPLHVACK------DGNMPIVVALCE------ANC- 601
             .|.||:: |:.||...   .|..:...|:...:..:      ||:..:   ||.      :|| 
  Fly  3735 QTVARCRI-VVATLPDA---PDSPEISANSGTEILLRWKQPRDDGHSTV---LCYSLQYKLSNCD 3792

Human   602 -----------------NLDISNKYGRTPLHLAANNGILDVVRYLCLMGASVEALTTDGKTAEDL 649
                             :|..:..|   ...||:.|.|     ....||..|.|.|..|...:  
  Fly  3793 AWTTVADNIDHEFYLLHDLQPNTNY---QFRLASKNRI-----GWSEMGIPVSASTVGGDAPK-- 3847

Human   650 ARSEQHEHVAGLLARLRKDTHRG 672
                  .|:...:..|::.|..|
  Fly  3848 ------IHITKAMKHLQQLTENG 3864

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DAPK1NP_001275658.1 STKc_DAPK1 7..275 CDD:271096 99/296 (33%)
Calmodulin-binding 267..334 18/78 (23%)
Autoinhibitory domain. /evidence=ECO:0000250 292..301 1/8 (13%)
ANK 373..497 CDD:238125 16/128 (13%)
ANK repeat 378..409 CDD:293786 4/35 (11%)
ANK 1 378..407 4/33 (12%)
ANK 2 411..440 4/28 (14%)
ANK repeat 412..442 CDD:293786 5/29 (17%)
ANK 439..564 CDD:238125 30/180 (17%)
ANK repeat 444..475 CDD:293786 1/30 (3%)
ANK 3 444..473 0/28 (0%)
ANK repeat 477..508 CDD:293786 5/39 (13%)
ANK 4 477..506 5/37 (14%)
ANK 505..629 CDD:238125 36/209 (17%)
ANK repeat 510..541 CDD:293786 9/56 (16%)
ANK 5 510..539 8/34 (24%)
Ank_2 <515..768 CDD:330894 41/229 (18%)
ANK repeat 543..574 CDD:293786 12/51 (24%)
ANK 6 543..572 11/49 (22%)
ANK repeat 576..607 CDD:293786 8/60 (13%)
ANK 7 576..605 8/58 (14%)
ANK repeat 609..638 CDD:293786 8/28 (29%)
ANK 8 609..638 8/28 (29%)
ANK 9 875..904
ANK 10 1162..1196
Death_DAPK1 1308..1393 CDD:260052
Unc-89NP_001097440.1 RhoGEF 90..260 CDD:238091
PH_unc89 275..388 CDD:270134
Atrophin-1 <493..690 CDD:331285
TonB_N 502..>596 CDD:318287
I-set 1017..1108 CDD:333254
I-set 1123..1212 CDD:254352
I-set <1236..1299 CDD:333254
I-set 1313..1403 CDD:254352
Ig_3 1406..1487 CDD:316449
I-set 1499..1595 CDD:254352
I-set 1599..1690 CDD:333254
I-set 1694..1786 CDD:254352
I-set <1836..1903 CDD:333254
I-set 1922..2005 CDD:333254
I-set 2018..2108 CDD:333254
I-set 2113..2214 CDD:333254
I-set 2220..2302 CDD:254352
I-set 2318..2408 CDD:254352
I-set 2415..2506 CDD:254352
I-set 2519..2608 CDD:254352
I-set 2615..2696 CDD:254352
I-set 2717..2805 CDD:254352
FN3 2834..2925 CDD:238020
I-set <2996..3063 CDD:333254
I-set 3067..3157 CDD:333254 2/3 (67%)
PK_Unc-89_rpt1 3182..3440 CDD:271011 94/266 (35%)
I-set 3654..3744 CDD:333254 16/92 (17%)
FN3 3748..3840 CDD:238020 18/105 (17%)
STKc_Unc-89_rpt2 3893..4151 CDD:271014
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.