DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CLEC14A and egas-4

DIOPT Version :9

Sequence 1:NP_778230.1 Gene:CLEC14A / 161198 HGNCID:19832 Length:490 Species:Homo sapiens
Sequence 2:NP_501207.2 Gene:egas-4 / 3564809 WormBaseID:WBGene00018906 Length:883 Species:Caenorhabditis elegans


Alignment Length:148 Identity:41/148 - (27%)
Similarity:54/148 - (36%) Gaps:36/148 - (24%)


- Green bases have known domain annotations that are detailed below.


Human   166 ANGYLCKYQFEVLC-PAPRPGA-------ASNLSYRAPFQLHSAALDFSP-PGTEVSALCR--GQ 219
            |:||         | ||.|..|       .|:.|.:......:|....|| |.|..:..|.  ..
 Worm    23 AHGY---------CYPANRTSATTCSECTCSDESTQTSDTTCTAPTSCSPNPCTLSNQQCNMVND 78

Human   220 LPISVTCIADEIGARWDKLSGDVLCPCPGRYLRAGKCAELPNCLDDLGGFACECATGFELGKDGR 284
            :| :.||.....|.....|:.|...|.|        |.:...|....|.::|.|||||    .|.
 Worm    79 IP-TCTCAVGYTGTDCTMLTSDPCSPQP--------CLQNGVCSSSGGTYSCACATGF----FGE 130

Human   285 SCVTSGE---GQPTLGGT 299
            .|..||:   |..:.|||
 Worm   131 QCQYSGDPCSGYCSNGGT 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CLEC14ANP_778230.1 CLECT_thrombomodulin_like 32..175 CDD:153070 3/8 (38%)
FXa_inhibition 254..286 CDD:291342 10/31 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 286..349 7/17 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 428..461
egas-4NP_501207.2 EGF 101..131 CDD:278437 12/41 (29%)
EGF_CA 482..522 CDD:238011
ASC <610..869 CDD:279230
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C161463604
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.