DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CLEC14A and R05G6.9

DIOPT Version :9

Sequence 1:NP_778230.1 Gene:CLEC14A / 161198 HGNCID:19832 Length:490 Species:Homo sapiens
Sequence 2:NP_501215.2 Gene:R05G6.9 / 187624 WormBaseID:WBGene00019901 Length:378 Species:Caenorhabditis elegans


Alignment Length:182 Identity:42/182 - (23%)
Similarity:59/182 - (32%) Gaps:43/182 - (23%)


- Green bases have known domain annotations that are detailed below.


Human   116 LSSDPGGLESDTLQWVEEPQRSCTARRCAVLQATGGVEPAGWKE---MRCHLRANGYLCKYQFEV 177
            |.::|.||:.|.|:       .|||..|     .|.....|.|:   ..|:|...|:.|:.:...
 Worm   113 LLNNPFGLDDDALE-------MCTASDC-----NGNGVCVGSKKAPLCLCNLGKTGFKCESEISG 165

Human   178 LCPAPRPGAASNLSYRAPFQLHSAALDFSPPGTEVSALCRG-QLPISVTCIADEIGARWDKLSGD 241
            |.         |:...||...      .||.......||.| :...|..|.....|:|.:|..  
 Worm   166 LL---------NMDPSAPITF------CSPSDCNNKGLCLGTKNSFSCACQIGYTGSRCEKTP-- 213

Human   242 VLCPCPGRYLRAGKCAELPNCLDDLGGFACECATGFELGK----DGRSCVTS 289
             :..|..|     .|:....|:.......|.|..|:...|    .|..|..|
 Worm   214 -VALCDSR-----DCSSNGLCIGTKDSMTCACYLGYSGDKCEKITGTMCEAS 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CLEC14ANP_778230.1 CLECT_thrombomodulin_like 32..175 CDD:153070 17/61 (28%)
FXa_inhibition 254..286 CDD:291342 7/35 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 286..349 2/4 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 428..461
R05G6.9NP_501215.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C161463602
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.