DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CLEC14A and thbd

DIOPT Version :9

Sequence 1:NP_778230.1 Gene:CLEC14A / 161198 HGNCID:19832 Length:490 Species:Homo sapiens
Sequence 2:XP_012818722.2 Gene:thbd / 100485229 XenbaseID:XB-GENE-967380 Length:541 Species:Xenopus tropicalis


Alignment Length:281 Identity:76/281 - (27%)
Similarity:116/281 - (41%) Gaps:51/281 - (18%)


- Green bases have known domain annotations that are detailed below.


Human    36 ACYSLHHATMKRQAAEEACILRGGALSTVRAGAELRAVLALLRAGPGPGG--GSKDLLFWVALER 98
            :||.....:.:.:.||..|...||.|..||:..|...:..|:       |  |.|....|:.|| 
 Frog    36 SCYLGVWNSKRYKKAERQCTELGGNLMAVRSSVEAEVIEMLM-------GKLGDKVASVWIGLE- 92

Human    99 RRSHCTLENEPLRGFSWLSSDPGGLESDT--LQWVEEPQRSCTARRCAVLQATGGVEPAGWKEMR 161
            .|..||..:.|||||.|::.     ||:|  ..| :..:|.| ...|.|:.     :...|:|..
 Frog    93 LRGQCTDISLPLRGFQWVTG-----ESNTNYSNW-KSNERKC-GNLCVVVH-----KDLSWEEAV 145

Human   162 CHLRANGYLCKYQFEVLCPAPRPGAASNLSYRAPFQLHSAALDFSPPGTE-------VSALCRGQ 219
            |..:.:||||:..:...|.........:::|..|..:....:.|.||||:       :|.:|..|
 Frog   146 CDSKTDGYLCEIPYSASCQPIYFPQGLDVTYETPLGMAGPGITFLPPGTKAVIPSAHLSLVCEDQ 210

Human   220 LPISVTCIADEIGARWDKL----------SGDV---LCPC-PGRYLR--AGKCAELPN---CLDD 265
            ....:...:::.|| |:.:          :||.   .|.| |...|.  ...|..||:   |:.|
 Frog   211 GDGEMKWTSEDYGA-WNCMIENGGCSFICNGDTEGSRCECGPNTNLSDDGRSCMPLPSSLQCIPD 274

Human   266 LGGFACECATGFELGKDGRSC 286
            .....|.||.||.|.:||.:|
 Frog   275 QSTGTCVCAEGFALAEDGMTC 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CLEC14ANP_778230.1 CLECT_thrombomodulin_like 32..175 CDD:153070 42/142 (30%)
FXa_inhibition 254..286 CDD:291342 13/34 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 286..349 1/1 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 428..461
thbdXP_012818722.2 CLECT 32..156 CDD:413318 41/139 (29%)
FXa_inhibition 227..262 CDD:405372 6/34 (18%)
cEGF 279..299 CDD:403760 9/17 (53%)
EGF_CA 297..>327 CDD:214542
EGF_CA 336..>366 CDD:419698
vWFA <414..451 CDD:412136
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
NCBI 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.