DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TMTC3 and CG14921

DIOPT Version :9

Sequence 1:NP_861448.2 Gene:TMTC3 / 160418 HGNCID:26899 Length:914 Species:Homo sapiens
Sequence 2:NP_609491.1 Gene:CG14921 / 34547 FlyBaseID:FBgn0032345 Length:240 Species:Drosophila melanogaster


Alignment Length:189 Identity:39/189 - (20%)
Similarity:69/189 - (36%) Gaps:51/189 - (26%)


- Green bases have known domain annotations that are detailed below.


Human   713 SQTAKELKALPILEELLRYYPDHIKGLILKGDILMNQKKDILGAKKCFERILEMDPSNVQGKHNL 777
            |||.:::|....|..|:...||    ::|....|......|.     |||.|..:   :....:.
  Fly     5 SQTEEDIKISIELNRLVTRKPD----VVLLPQYLKFNNPPIF-----FERHLAQE---IDEMASF 57

Human   778 CVVYFEEKD--LLKAERCLL-ETLALAPHEEYIQRHLNIVRDKISSSSFIEPIFPTSKISSVEGK 839
            |.::..|..  |:|.|:.|. |.......|..:|:.|.|. |.|                 ||  
  Fly    58 CRIFKNEARIVLVKKEKGLWPEMFQKLDKEALMQKRLEIA-DLI-----------------VE-- 102

Human   840 KIPTESVKEIRGESRQTQIVKTSDNKSQSKSNKQLGKNGDEETPHKTTKDIKEIEKKRV 898
                      |.:.|..:.::..|||.:::..|::.:..|      ..:.:|:.::..|
  Fly   103 ----------RNKKRDEKALERYDNKRRAEIQKEIQRETD------MRERVKQFQENSV 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TMTC3NP_861448.2 DUF1736 259..331 CDD:312047
TPR 1 412..445
TPR_11 <435..802 CDD:330823 22/91 (24%)
TPR 2 446..479
TPR repeat 446..474 CDD:276809
TPR repeat 479..523 CDD:276809
TPR 3 481..513
TPR 4 528..562
TPR repeat 530..557 CDD:276809
TPR repeat 562..592 CDD:276809
TPR 5 563..596
TPR repeat 597..625 CDD:276809
TPR 7 668..701
TPR repeat 668..696 CDD:276809
TPR repeat 701..731 CDD:276809 6/17 (35%)
TPR 8 703..735 7/21 (33%)
TPR 9 736..770 7/33 (21%)
TPR repeat 736..765 CDD:276809 6/28 (21%)
TPR repeat 771..799 CDD:276809 7/30 (23%)
TPR 10 772..804 7/34 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 847..891 7/43 (16%)
CG14921NP_609491.1 p23_DYX1C1_like 4..81 CDD:107226 22/87 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.