DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TMTC3 and CG31690

DIOPT Version :9

Sequence 1:NP_861448.2 Gene:TMTC3 / 160418 HGNCID:26899 Length:914 Species:Homo sapiens
Sequence 2:NP_995615.2 Gene:CG31690 / 33455 FlyBaseID:FBgn0051690 Length:859 Species:Drosophila melanogaster


Alignment Length:906 Identity:266/906 - (29%)
Similarity:388/906 - (42%) Gaps:200/906 - (22%)


- Green bases have known domain annotations that are detailed below.


Human     2 ANINLKEITLIVG---VVTACYWNSLFCGFVFDDVSAILDNKDLHPSTPLKTLFQNDFWGTPMSE 63
            |.::.|::..:.|   :....|.|:|..|||:||..|||.|.|:..:.||..|.:|||||||:.:
  Fly    13 ATLSHKDLAGLAGCSALAFVLYLNTLNAGFVYDDRRAILANGDVTGARPLANLLRNDFWGTPLVD 77

Human    64 ERSHKSYRPLTVLTFRLNYLLSELKPMSYHLLNMIFHAVVSVIFLKVCKLFLDNKSSVIAS-LLF 127
            ..||.|:|||.||:||||||...:.|:.|||:|::.|.|.:.:...|.:..|.::..|:|: .||
  Fly    78 SGSHGSWRPLCVLSFRLNYLAGGMTPLGYHLVNVMLHCVATWLVFLVARTLLPSRMGVLAAGALF 142

Human   128 AVHPIHTEAVTGVVGRAELLSSIFFLAAFLSYTRSKGPDNSIIWTPIALTVFLVAVATLCKEQGI 192
            ||||.|||||.|:||||:|.|.:.:|.|:|||.|..   .:..|..:.||:.|...|.||||..|
  Fly   143 AVHPAHTEAVAGLVGRADLASCVCYLLAYLSYRRHM---LNREWGSLILTIMLALAALLCKETAI 204

Human   193 TVVGICCVYEVFIAQG-YTLPLLCTTAGQFLRGKGSI----PFSMLQTLVKLIVLMFSTLLLVVI 252
            |.:.:|.:.:|....| .....:|         .|||    .|:..:....|.:|.|:.|..:..
  Fly   205 TALLLCGLCDVLSPVGRENSDKVC---------DGSISGLASFNFQRRFRSLSILGFTLLCGLYC 260

Human   253 RVQVIQSQLPVFTRFDNPAA-VSPTPTRQLTFNYLLPVNAWLLLNPSELCCDWTMGTIPLIESLL 316
            |:.::......|:..|||.| .|...||.|||.||...|..:||.|.||..||.|..:..|.:|.
  Fly   261 RLSLLPRPSTAFSAADNPTAHESCFWTRTLTFLYLPVANFGILLWPQELSFDWGMEAVSRIRTLW 325

Human   317 DIRNLATFTFF----------------------------------------C--FLGM------- 332
            |.||:.|..|:                                        |  :||:       
  Fly   326 DARNILTAGFYGSLVAILWKGSGLRSAASPMDFAEVANISLPLLRRLGGNSCHTWLGLTCDCHHQ 390

Human   333 LGVFSIR-----YSGDS-SKTV------LMALCLMALPFIPASNLFFPVGFVVAERVLYVPSMGF 385
            |...|.|     ||..| ||:.      ::....:.|||:|||||.|.||||:||||||:||:|:
  Fly   391 LSAPSYRSASAIYSTSSKSKSASWTAAPILGTAFLVLPFLPASNLLFYVGFVMAERVLYLPSVGY 455

Human   386 CIL----VAHGWQKISTKSVFKKLSWIC-LSMVILTHSLKTFHRNWDWESEYTLFMSALKVNKNN 445
            |:|    ..|.||:::: |...:|..:| |::::..|.::||.||.||..|..||.||:.:|.  
  Fly   456 CLLFGLGFGHLWQRVNS-SWRSRLMLLCGLALLLGVHGVRTFRRNLDWRDEEQLFRSAISINP-- 517

Human   446 AKLWNNVGHALENEKNFERALKYFLQATHVQPDDIGAHMNVGRTY-KNLNRTKEAEESYMMAKSL 509
            .|...|:|..|..:..:|.|..........:|....||.|:|..: |.||               
  Fly   518 PKALGNLGSVLSAQGRYEEAELTLRMTLGHRPTMADAHFNLGVVHQKQLN--------------- 567

Human   510 MPQIIPGKKYAARIAPNHLNVYINL-ANLIRANESRLEEADQLYRQAISMRP------------- 560
            ....||..:.|..:.|.....|:|| .:||...:.| :||..:.|....:..             
  Fly   568 FSSAIPCFRRAIELRPQLAVAYLNLGTSLISLGDHR-QEAISVLRTGARLEGSGVRDRGAHVEAR 631

Human   561 -----DFKQAYISRGELLLKMNKPLKAKEAYLKALEL--DRNNADLWYNLAIVHIELKEPNEALK 618
                 .....|.|.|    ::.....|....||||.|  .:..|.|...|..:..||::.|||..
  Fly   632 YTCYLQLSVLYRSDG----RLQDAAAALRESLKALPLLPQKQRAVLHLRLGEILAELQDWNEAEH 692

Human   619 NFNRALELNPKHKLALFNSAIVMQESGEVKLRPEA-RKRLLSYINEEPLDANGYFN--------- 673
            ....|::|.|:...|.......:..:|......|: .||.|.....||...:.|.:         
  Fly   693 QQRLAMQLQPEQGAAYVTYGQTLARNGSRLAEAESWFKRALQLAPLEPSSHHHYADFLEQQERHH 757

Human   674 --LGM------LAMDD--------------KKDNEAEIWMKKAIKLQADFRSALFNLALLYSQTA 716
              ||:      ||..|              .:..|||:|.:||:.||.....|..||        
  Fly   758 EALGLRLRAAALAPQDYTLQSCVADALRLLNRLAEAELWYRKAVTLQPMAAHAHANL-------- 814

Human   717 KELKALPILEELLRYYPDHIKGLILKGDILMNQKKDILGAKKCFERILEMDPSNVQGKHNL 777
                                 |.||:   :...:|:   |..|:.:.||:.|.:...:.||
  Fly   815 ---------------------GAILQ---MRGLRKE---AVACYHKALELQPGHAISRANL 848

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TMTC3NP_861448.2 DUF1736 259..331 CDD:312047 30/114 (26%)
TPR 1 412..445 13/32 (41%)
TPR_11 <435..802 CDD:330823 87/397 (22%)
TPR 2 446..479 7/32 (22%)
TPR repeat 446..474 CDD:276809 6/27 (22%)
TPR repeat 479..523 CDD:276809 10/44 (23%)
TPR 3 481..513 7/32 (22%)
TPR 4 528..562 9/52 (17%)
TPR repeat 530..557 CDD:276809 9/27 (33%)
TPR repeat 562..592 CDD:276809 8/29 (28%)
TPR 5 563..596 9/34 (26%)
TPR repeat 597..625 CDD:276809 9/27 (33%)
TPR 7 668..701 14/63 (22%)
TPR repeat 668..696 CDD:276809 12/58 (21%)
TPR repeat 701..731 CDD:276809 3/29 (10%)
TPR 8 703..735 3/31 (10%)
TPR 9 736..770 9/33 (27%)
TPR repeat 736..765 CDD:276809 6/28 (21%)
TPR repeat 771..799 CDD:276809 2/7 (29%)
TPR 10 772..804 2/6 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 847..891
CG31690NP_995615.2 DUF1736 272..340 CDD:285594 29/67 (43%)
TPR_11 518..583 CDD:290150 17/79 (22%)
TPR repeat 518..546 CDD:276809 6/27 (22%)
TPR repeat 551..581 CDD:276809 10/44 (23%)
TPR_1 552..584 CDD:278916 10/46 (22%)
TPR 565..841 CDD:223533 69/330 (21%)
TPR repeat 586..611 CDD:276809 8/25 (32%)
TPR repeat 634..660 CDD:276809 4/29 (14%)
TPR repeat 671..699 CDD:276809 9/27 (33%)
TPR repeat 704..735 CDD:276809 6/30 (20%)
TPR repeat 740..768 CDD:276809 4/27 (15%)
TPR repeat 773..803 CDD:276809 7/29 (24%)
TPR 808..841 CDD:197478 12/67 (18%)
TPR repeat 808..836 CDD:276809 9/62 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1320023at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.