DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Igfals and Toll-6

DIOPT Version :9

Sequence 1:NP_001351825.1 Gene:Igfals / 16005 MGIID:107973 Length:638 Species:Mus musculus
Sequence 2:NP_001246765.1 Gene:Toll-6 / 39663 FlyBaseID:FBgn0036494 Length:1514 Species:Drosophila melanogaster


Alignment Length:686 Identity:184/686 - (26%)
Similarity:276/686 - (40%) Gaps:150/686 - (21%)


- Green bases have known domain annotations that are detailed below.


Mouse    11 QVREHSRSI-GKA-LGNRANCLSLTEPSAPYR----------GSPALVVLLAFWVALGPCYLQGT 63
            |...||.:| |:| :.|.    .|.:||.|.|          |.|:|      :.|...|:..  
  Fly    32 QQLSHSNAIMGEAGVSNS----QLMQPSTPARTLRPLTAGAGGDPSL------YDAPDDCHFM-- 84

Mouse    64 DPGASADAEGPQCPVTC----------TCSYD----DYTDELSVFCSS----------------- 97
             |.|..|.  |:..:||          |.::.    ::|..|.:.|:.                 
  Fly    85 -PAAGLDQ--PEIALTCNLRTVNSEFDTTNFSVIPAEHTIALHILCNDEIMAKSRLEAQSFAHLV 146

Mouse    98 --------------------------RNLTQL--------------PDSIPVSTR--ALWLDGNN 120
                                      ||||..              .|:..|:.|  .|.|..||
  Fly   147 RLQQLSIQYCKLGRLGRQVLDGLEQLRNLTLRTHNILWPALNFEIEADAFSVTRRLERLDLSSNN 211

Mouse   121 LSSIPSAAFQNLSSLDFLNLQGSWL----------RSLEP----------------------QAL 153
            :.|:|...|..||.|..||:..:.|          ||.||                      ...
  Fly   212 IWSLPDNIFCTLSELSALNMSENRLQDVNELGFRDRSKEPTNGSTESTSTTESAKKSSSSSTSCS 276

Mouse   154 LGLQNLYHLHLERNLLRSLAAGLFRHTPSLASLSLGNNLLGRLEEGLFRGLSHLWDLNLGWNSLV 218
            |.|:   :|.:..|....|.|..|.....|..||:.||.:..:.:....||.:|..|||..|.:|
  Fly   277 LDLE---YLDVSHNDFVVLPANGFGTLRRLRVLSVNNNGISMIADKALSGLKNLQILNLSSNKIV 338

Mouse   219 VLPDTVFQGLGN-LHELVLAGNKLTYLQPALLCGLGELRELDLSRNALRS--VKANVFIHLPRLQ 280
            .||..:|..... :.|:.|..|.::.|.|.|...|.:|:.||||.|.:.|  :..|.|:.|.||.
  Fly   339 ALPTELFAEQAKIIQEVYLQNNSISVLNPQLFSNLDQLQALDLSMNQITSTWIDKNTFVGLIRLV 403

Mouse   281 KLYLDRNLITAVAPRAFLGMKALRWLDLSHNRVAGLLEDTFPGLLGLHVLRLAHNAITSLRPRTF 345
            .|.|..|.:|.:.|..|..:..|:.|:|.||::..:..|||..:..||.|.|:||.:..|.....
  Fly   404 LLNLSHNKLTKLEPEIFSDLYTLQILNLRHNQLENIAADTFAPMNNLHTLLLSHNKLKYLDAYAL 468

Mouse   346 KDLHFLEELQLGHNRIRQLGEKTFEGLGQLEVLTLNDNQIHEVKVGAFFGLFNVAVMNLSGNCLR 410
            ..|:.|..|.|.:|.:..:....|.....|:.|.||.||:..|.: |...:.::..::|..|.:.
  Fly   469 NGLYVLSLLSLDNNALIGVHPDAFRNCSALQDLNLNGNQLKTVPL-ALRNMRHLRTVDLGENMIT 532

Mouse   411 SLPEHVFQGLGRLHSLHLEHSCLGRIRLHTFAGLSGLRRLFLRDNSISSIEEQSLAGLSELLELD 475
            .:.:..|:|||.|:.|.|..:.|..|.:|||..|..|:.|.|..|.|:.:|..:....|.:..:.
  Fly   533 VMEDSAFKGLGNLYGLRLIGNYLENITMHTFRDLPNLQILNLARNRIAVVEPGAFEMTSSIQAVR 597

Mouse   476 LTANQLTHLPRQLFQGLGQLEYLLLSNNQLTMLS-EDVLGPLQRAFWLDLSHNRLETPAE--GLF 537
            |..|:|..: ..||..:..|.:|.:|:|:|.... ..|...||   ||||..|||.:.:.  ||.
  Fly   598 LDGNELNDI-NGLFSNMPSLLWLNISDNRLESFDYGHVPSTLQ---WLDLHKNRLSSLSNRFGLD 658

Mouse   538 SSLGRLRYLNLRNNSLQTFVPQP---GLERLWLDAN 570
            |.| :|:.|::..|.||...|..   .:|.|:|:.|
  Fly   659 SEL-KLQTLDVSFNQLQRIGPSSIPNSIELLFLNDN 693

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IgfalsNP_001351825.1 LRRNT 75..113 CDD:214470 13/110 (12%)
leucine-rich repeat 92..110 CDD:275380 6/74 (8%)
PLN00113 96..>558 CDD:331614 152/558 (27%)
leucine-rich repeat 114..134 CDD:275380 8/19 (42%)
leucine-rich repeat 135..158 CDD:275380 10/54 (19%)
leucine-rich repeat 159..182 CDD:275380 5/22 (23%)
leucine-rich repeat 183..206 CDD:275380 7/22 (32%)
leucine-rich repeat 207..230 CDD:275380 9/22 (41%)
leucine-rich repeat 231..254 CDD:275380 7/22 (32%)
leucine-rich repeat 255..278 CDD:275380 10/24 (42%)
leucine-rich repeat 279..302 CDD:275380 7/22 (32%)
leucine-rich repeat 303..326 CDD:275380 8/22 (36%)
leucine-rich repeat 327..350 CDD:275380 8/22 (36%)
leucine-rich repeat 351..374 CDD:275380 5/22 (23%)
leucine-rich repeat 375..396 CDD:275380 8/20 (40%)
leucine-rich repeat 423..446 CDD:275380 9/22 (41%)
leucine-rich repeat 447..470 CDD:275380 6/22 (27%)
leucine-rich repeat 471..494 CDD:275380 5/22 (23%)
leucine-rich repeat 495..516 CDD:275380 6/21 (29%)
leucine-rich repeat 519..542 CDD:275380 11/24 (46%)
leucine-rich repeat 543..561 CDD:275380 6/20 (30%)
TPKR_C2 570..613 CDD:326558 1/1 (100%)
Toll-6NP_001246765.1 leucine-rich repeat 148..171 CDD:275380 0/22 (0%)
LRR_8 171..236 CDD:290566 19/64 (30%)
leucine-rich repeat 172..201 CDD:275380 6/28 (21%)
leucine-rich repeat 202..278 CDD:275380 17/75 (23%)
leucine-rich repeat 229..249 CDD:275380 4/19 (21%)
LRR_RI 278..468 CDD:238064 62/192 (32%)
leucine-rich repeat 279..302 CDD:275380 6/25 (24%)
LRR_8 301..386 CDD:290566 29/84 (35%)
leucine-rich repeat 303..326 CDD:275380 7/22 (32%)
leucine-rich repeat 327..350 CDD:275380 9/22 (41%)
LRR 350..729 CDD:227223 110/350 (31%)
leucine-rich repeat 352..375 CDD:275380 7/22 (32%)
leucine-rich repeat 376..401 CDD:275380 10/24 (42%)
LRR_RI <401..626 CDD:238064 68/226 (30%)
leucine-rich repeat 402..425 CDD:275380 7/22 (32%)
leucine-rich repeat 426..449 CDD:275380 8/22 (36%)
leucine-rich repeat 450..473 CDD:275380 8/22 (36%)
leucine-rich repeat 474..497 CDD:275380 5/22 (23%)
leucine-rich repeat 498..518 CDD:275380 8/20 (40%)
leucine-rich repeat 521..544 CDD:275380 5/22 (23%)
leucine-rich repeat 545..566 CDD:275380 8/20 (40%)
leucine-rich repeat 569..592 CDD:275380 6/22 (27%)
leucine-rich repeat 593..615 CDD:275380 5/22 (23%)
leucine-rich repeat 616..637 CDD:275380 6/20 (30%)
leucine-rich repeat 638..662 CDD:275380 13/27 (48%)
leucine-rich repeat 663..684 CDD:275380 6/20 (30%)
leucine-rich repeat 685..708 CDD:275380 4/9 (44%)
leucine-rich repeat 709..728 CDD:275380
LRR_8 883..943 CDD:290566
leucine-rich repeat 885..908 CDD:275380
leucine-rich repeat 909..932 CDD:275380
LRR_8 932..990 CDD:290566
leucine-rich repeat 933..956 CDD:275380
TIR 1114..1247 CDD:214587
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45836
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.