DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC5A12 and CG34337

DIOPT Version :9

Sequence 1:NP_848593.2 Gene:SLC5A12 / 159963 HGNCID:28750 Length:618 Species:Homo sapiens
Sequence 2:NP_001096901.1 Gene:CG34337 / 5740569 FlyBaseID:FBgn0085366 Length:71 Species:Drosophila melanogaster


Alignment Length:92 Identity:19/92 - (20%)
Similarity:33/92 - (35%) Gaps:36/92 - (39%)


- Green bases have known domain annotations that are detailed below.


Human   283 LWIILVCAVFSGLIMYSHFKDCDPWTSGIISAP--DQLMPYFVMEIFATMPGLPGLFVACAFSGT 345
            :::.|.|.:|.|       :.|       ::||  |.|..:..||                  .:
  Fly     7 IFLALTCVLFMG-------QSC-------LAAPSADDLAKFGEME------------------RS 39

Human   346 LSTVASSINAL--ATVTFEDFVKSCFP 370
            :..:.|||.|:  ||..|.....:.:|
  Fly    40 IKELTSSILAMSGATTGFRPGANNVWP 66

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLC5A12NP_848593.2 SLC5sbd_SMCT2 3..527 CDD:212089 19/92 (21%)
CG34337NP_001096901.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.