DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ifit3 and Utx

DIOPT Version :9

Sequence 1:XP_011245453.1 Gene:Ifit3 / 15959 MGIID:1101055 Length:434 Species:Mus musculus
Sequence 2:NP_609368.3 Gene:Utx / 34377 FlyBaseID:FBgn0260749 Length:1136 Species:Drosophila melanogaster


Alignment Length:431 Identity:70/431 - (16%)
Similarity:152/431 - (35%) Gaps:138/431 - (32%)


- Green bases have known domain annotations that are detailed below.


Mouse    26 GNVHDHANEV-NRESLEAILPQLKCHFTWNLFREGSMSSHMEDRVCNQVEHLNSEEKATMYDLLA 89
            |.||:..|.. |:.:::...|..:.            ..|||    |.....|.:.|..      
  Fly    51 GQVHESKNSSDNKNAIQKFEPSTQA------------GEHME----NTSSRNNDDTKPF------ 93

Mouse    90 YIKHLDGESKAALECLGQAEDLRKSEHNDQSEIRRLVTWGNYAWIYYHMGRLSEA-QAYVDKVRQ 153
               ..|.:.|.:         :.:.:|.|:..:..|...|:   ::..:|..||| .||      
  Fly    94 ---EQDAKEKVS---------IIEEKHQDEHYVNALCKLGH---LHLLLGEYSEALSAY------ 137

Mouse   154 VCQKF----ANPYSMECPELECEEGWT-------------RLKCGRNERAKMCFEKALEEKPKDP 201
              ||:    .|.|            ||             :|:|.:  .|...|::.|...| :.
  Fly   138 --QKYLRFRENNY------------WTNHAFIYGIGVAYFKLRCFK--WAIKSFQELLYLSP-NF 185

Mouse   202 ECSSGMAIAM-FRLEEKPEKQFSVDALKQAMELNPQNQYLKVLLALKLLRMGEEAEGERLIKDAL 265
            .|::.:.:.: ..|:...|...::..|:.|:.....:.:.::.:..::..:.|.....:..||..
  Fly   186 TCANEVHLRLGLMLKHCGEFHIALKHLQLALLYTYPSTFSELQVKFQIAHLYEVQNKHKAAKDGY 250

Mouse   266 GKAPNQTDV-LQKAAQFYKKKGNLDRAIELLGKALRSTVNNSPLYSLVMCRYREILEQLQNKGDA 329
            ....|:.:: |:..|..|::.|.:...:|.||                                 
  Fly   251 EFLLNEKNISLELKADVYRQLGWMYHCVECLG--------------------------------- 282

Mouse   330 DSSERRQRMAELRRLTMEFMQKTLQRRRSPLNSYSDLIDFPEVERCYQMV-------ISKESPDV 387
               |:::|.|.    .:.|:||:::  ..|.:..|..:    :.|||..:       ::..:...
  Fly   283 ---EKKEREAN----ALNFLQKSIE--ADPKSGQSLYL----LGRCYAGINKVHDAFLAYRNSVE 334

Mouse   388 EEEDLYERYCNL----QEYHRKSEDLAALECLLQFPRNERS 424
            :.|...:.:|::    |:.::.::.|.|..|.:|..::.::
  Fly   335 KSEGNADTWCSIGVLYQQQNQPTDALQAYICAVQLDKDHKA 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ifit3XP_011245453.1 TPR_12 82..157 CDD:315987 12/75 (16%)
TPR repeat 82..110 CDD:276809 2/27 (7%)
PEP_TPR_lipo <87..>331 CDD:274350 40/263 (15%)
TPR repeat 115..154 CDD:276809 10/39 (26%)
TPR repeat 167..195 CDD:276809 6/40 (15%)
TPR repeat 200..233 CDD:276809 5/33 (15%)
TPR repeat 272..300 CDD:276809 7/28 (25%)
UtxNP_609368.3 TPR repeat 147..181 CDD:276809 8/47 (17%)
TPR_11 156..216 CDD:290150 10/62 (16%)
TPR repeat 186..216 CDD:276809 4/29 (14%)
TPR repeat 228..255 CDD:276809 3/26 (12%)
TPR_11 264..337 CDD:290150 17/118 (14%)
TPR repeat 265..300 CDD:276809 12/74 (16%)
TPR repeat 307..334 CDD:276809 4/30 (13%)
TPR_11 339..402 CDD:290150 6/37 (16%)
TPR repeat 339..369 CDD:276809 5/29 (17%)
TPR_1 340..373 CDD:278916 6/32 (19%)
TPR repeat 374..402 CDD:276809 0/2 (0%)
JmjC 870..978 CDD:202224
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.