DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP51A1 and Cyp6a21

DIOPT Version :9

Sequence 1:NP_000777.1 Gene:CYP51A1 / 1595 HGNCID:2649 Length:509 Species:Homo sapiens
Sequence 2:NP_611003.2 Gene:Cyp6a21 / 36665 FlyBaseID:FBgn0033981 Length:504 Species:Drosophila melanogaster


Alignment Length:501 Identity:110/501 - (21%)
Similarity:191/501 - (38%) Gaps:81/501 - (16%)


- Green bases have known domain annotations that are detailed below.


Human    34 SMLLIACAFTLSLV-YLI---RLAAGHLVQLPAGVKSPPYIFSPIPFLGHAIAFGKSPIEFLENA 94
            ::||.|   .|:|| ||:   |....|...|....:.|..:...:..:..|.:|.    |...:.
  Fly     5 TVLLTA---LLALVGYLLMKWRSTMRHWQDLGIPCEEPHILMGSMKGVRTARSFN----EIWTSY 62

Human    95 YEKY---GPVFSFTMVGKTFTYLLGSDAAALL-------FNSKNEDLNAEDVYSRLTTPVFGKGV 149
            |.|:   ||...|....:...::|.:..|..:       |..:....|.||      .|:.|:..
  Fly    63 YNKFRGSGPFAGFYWFRRPAVFVLETSLAKQILIKEFNKFTDRGFFHNPED------DPLSGQLF 121

Human   150 AYDVPNPVFLEQKKMLKSGLNIAHFKQHVSIIEKETKEYFESWGESGEKN----VFEALSELIIL 210
            ..|  ...:...:..|.|.......|.....:.|...|:.:.:|::..|:    |.|.|:.....
  Fly   122 LLD--GQKWRTMRNKLSSTFTSGKMKYMFPTVVKVANEFTDVFGQNVAKSPVVEVRELLARFTTD 184

Human   211 TASHCLHGKEI--------------RSQLNEKVAQLYADLDGGFSHAAWLLPGWLPLPSFRRRDR 261
            ....|..|.|.              |..|.|   |....:..||.::         .|:..|  |
  Fly   185 VIGTCAFGIECSSLKDPDAEFREMGRRSLTE---QRLGPVGIGFVNS---------FPNLAR--R 235

Human   262 AHRE-----IKDIFYKAIQK----RRQSQEKIDDILQTLLDATYK--------DGRPLTDDEVAG 309
            .|.:     |:..|.:.:::    |.|:..:.:|.:..|:|...|        :...||.:|:|.
  Fly   236 LHMKMTAEPIERFFMRIVRETVAFREQNNIRRNDFMDQLIDLKNKPLMVSQSGESVNLTIEEIAA 300

Human   310 MLIGLLLAGQHTSSTTSAWMGFFLARDKTLQKKCYLEQKTVCGENLPPLTYDQLKDLNLLDRCIK 374
            .......||..|||||..:..:.||:::.:|.:...|.:.|..:....|.|:.:|||..||:.:.
  Fly   301 QAFVFFAAGFETSSTTMGFALYELAQNQDIQNRVRKECQEVIEKCNGELNYESMKDLVYLDQVVS 365

Human   375 ETLRLRPPIMIMMRMARTPQTVAG---YTIPPGHQVCVSPTVNQRLKDSWVERLDFNPDRYLQDN 436
            |||||...:.::.|.......|.|   |.|..|..|.:......|.:..:.....||||.:..:.
  Fly   366 ETLRLYTVLPVLNRECLEDYEVPGHPKYVIKKGMPVLIPCGAMHRDEKLYANPNTFNPDNFSPER 430

Human   437 PASGEKFAYVPFGAGRHRCIGENFAYVQIKTIWSTMLRLYEFDLID 482
            ....:...::|||.|...|||..|..:|.:...:.:::.::|.:.:
  Fly   431 VKERDSVEWLPFGDGPRNCIGMRFGQMQARIGLALLIKDFKFSVCE 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP51A1NP_000777.1 p450 67..483 CDD:299894 99/464 (21%)
Cyp6a21NP_611003.2 p450 35..499 CDD:278495 99/468 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.