DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP27B1 and Cyp12a5

DIOPT Version :9

Sequence 1:NP_000776.1 Gene:CYP27B1 / 1594 HGNCID:2606 Length:508 Species:Homo sapiens
Sequence 2:NP_650782.1 Gene:Cyp12a5 / 42293 FlyBaseID:FBgn0038680 Length:536 Species:Drosophila melanogaster


Alignment Length:495 Identity:131/495 - (26%)
Similarity:221/495 - (44%) Gaps:91/495 - (18%)


- Green bases have known domain annotations that are detailed below.


Human    39 DIPGPSTPSFLAELFCKGGLSRLHEL--------QVQGAAHFGPVWLASFGTVRTVYVAAPALVE 95
            :||..:..|..|:....||..:..|:        |..|...|.|..:...|.|.|   ..|...|
  Fly    49 EIPKANILSLFAKSALPGGKYKNLEMMEMIDALRQDYGNIIFLPGMMGRDGLVMT---HNPKDFE 110

Human    96 ELLRQEGPRPERCSFSPWTE----HRRCRQR-----ACGLLTAEGEEWQRLRSLLAPLLLRPQAA 151
            .:.|.||..|    |.|.::    ||...::     ..|::.::|:.|...||::.|:|::|:..
  Fly   111 VVFRNEGVWP----FRPGSDILRYHRTVYRKDFFDGVQGIIPSQGKSWGDFRSIVNPVLMQPKNV 171

Human   152 ARYAGTLNNVVCDLVRRLRRQRGRGTGPPALVRDVAGEFY----KFGLEGIAAVLLGSRLGCLEA 212
            ..|...::.|..:.|..::..|...|      ::|.|.|.    ::.||.::.|.|..:||.|  
  Fly   172 RLYFKKMSQVNQEFVELIKEIRDAST------QEVPGNFLETINRWTLESVSVVALDKQLGLL-- 228

Human   213 QVPPDTETFIRAVGSVFVSTLLTMAMPHWLRH-----LVPGPW--------GRLCRDWDQM---- 260
                      |..|....:|.|...:..:..|     :.|..|        .::.|..|.:    
  Fly   229 ----------RESGKNSEATKLFKYLDEFFLHSADLEMKPSLWRYFKTPLLKKMLRTMDSVQEVT 283

Human   261 FAFAQRHVERREAEAAMRNG-GQPEKD---LESGAHLTHFLFREELPAQSILGNVTELLLAGVDT 321
            ..:....:||.|.||  :.| .:||.:   ||.       |.:.:....:::  ..::|:|||||
  Fly   284 LKYVDEAIERLEKEA--KEGVVRPEHEQSVLEK-------LLKVDKKVATVM--AMDMLMAGVDT 337

Human   322 VSNTLSWALYELSRHPEVQTALHSEITAALSPGSSAYPSATVLSQLPLLKAVVKEVLRLYPVVPG 386
            .|:|.:..|..|:::||.|..|..|:...|....|.:..|: :..:|.|:|.:||..|:||:|.|
  Fly   338 TSSTFTALLLCLAKNPEKQARLREEVMKVLPNKDSEFTEAS-MKNVPYLRACIKESQRVYPLVIG 401

Human   387 NSRVPDKDIHVGDYIIPKNTLVTLCHYATSRDPAQFPEPNSFRPARWL-------GEGP-----T 439
            |:|...:|..:..|.:|..|:|::....:......||:|..|.|.|||       |:.|     |
  Fly   402 NARGLTRDSVISGYRVPAGTIVSMIPINSLYSEEYFPKPTEFLPERWLRNASDSAGKCPANDLKT 466

Human   440 PHPFASLPFGFGKRSCMGRRLAELELQMALAQILTHFEVQ 479
            .:||..||||||.|.|:|:|:.|:||::..|:::.:|.|:
  Fly   467 KNPFVFLPFGFGPRMCVGKRIVEMELELGTARLIRNFNVE 506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP27B1NP_000776.1 p450 41..505 CDD:278495 130/493 (26%)
Cyp12a5NP_650782.1 p450 81..531 CDD:278495 124/463 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 194 1.000 Domainoid score I3171
eggNOG 1 0.900 - - E2759_KOG0159
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 201 1.000 Inparanoid score I3768
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48087
OrthoDB 1 1.010 - - D185685at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8467
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X156
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.880

Return to query results.
Submit another query.