DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP27B1 and shd

DIOPT Version :9

Sequence 1:NP_000776.1 Gene:CYP27B1 / 1594 HGNCID:2606 Length:508 Species:Homo sapiens
Sequence 2:NP_001261843.1 Gene:shd / 39592 FlyBaseID:FBgn0003388 Length:540 Species:Drosophila melanogaster


Alignment Length:537 Identity:131/537 - (24%)
Similarity:222/537 - (41%) Gaps:98/537 - (18%)


- Green bases have known domain annotations that are detailed below.


Human    30 YHS----------ARRSLADIPGPSTPSFLAE------LFCKGGLSRLHELQVQGAAHFGPVWLA 78
            ||:          .||.:.|||||....||..      .|.:..:::|||:.......:|.:.|.
  Fly    42 YHAELIQPEAPKRRRRGIWDIPGPKRIPFLGTKWIFLLFFRRYKMTKLHEVYADLNRQYGDIVLE 106

Human    79 SF-GTVRTVYVAAPALVEELLRQEGPRPERCSFSPWTE-------HRRCRQRACGLLTAEGEEWQ 135
            .. ..|..|::.....:|::|:.    |.:..|.|.||       .|..|..:.|::..:|..||
  Fly   107 VMPSNVPIVHLYNRDDLEKVLKY----PSKYPFRPPTEIIVMYRQSRPDRYASVGIVNEQGPMWQ 167

Human   136 RLRSLLAPLLLRPQAAARYAGTLNNVVCDLVRRLRRQRGRGTGPPALV----RDVAGEFYKFGLE 196
            ||||.|...:..|:....:...||.|..|.:..||.:|    .|..||    .::|.   ..|||
  Fly   168 RLRSSLTSSITSPRVLQNFLPALNAVCDDFIELLRARR----DPDTLVVPNFEELAN---LMGLE 225

Human   197 GIAAVLLGSRLG--CLEAQVPPDTETFIRAVGSVFVSTLLTMAMPHWLRHLVPGPW----GRLCR 255
            .:..::||.|:|  .::.:.|........||..:|:|...:        :...|.|    .:..|
  Fly   226 AVCTLMLGRRMGFLAIDTKQPQKISQLAAAVKQLFISQRDS--------YYGLGLWKYFPTKTYR 282

Human   256 D--------WDQMFAFAQRHVERREAEAAMRNGGQPEKDLESGAH--LTHFLFREELPAQSILGN 310
            |        :|.:.......:|..:..||.      |.|..:|..  ..:.|..::|..:.....
  Fly   283 DFARAEDLIYDVISEIIDHELEELKKSAAC------EDDEAAGLRSIFLNILELKDLDIRDKKSA 341

Human   311 VTELLLAGVDTVSNTLSWALYELSRHPEVQTALHSEITAALSPGSSAYPSATV----LSQLPLLK 371
            :.:.:.||::|::|||.:.|..::..|.....:.||.        ..|....:    |:.....|
  Fly   342 IIDFIAAGIETLANTLLFVLSSVTGDPGAMPRILSEF--------CEYRDTNILQDALTNATYTK 398

Human   372 AVVKEVLRLYPVVPGNSRVPDKDIHVGDYIIPKNTLVTLCH--YATSRDPAQFPEPNSFRPARWL 434
            |.::|..||.|.....:|:.::|:.:..|.:...|:| ||.  .|..:| :.|.....|.|.||:
  Fly   399 ACIQESYRLRPTAFCLARILEEDMELSGYSLNAGTVV-LCQNMIACHKD-SNFQGAKQFTPERWI 461

Human   435 GEGPTPHPF------ASL--PFGFGKRSCMGRRLAELELQMALAQILTHFEVQPEPGAAPVRPKT 491
              .|....|      ||:  |||.|:|||.|:|..|:|:.:.||:::..|:|.   ...|:..:.
  Fly   462 --DPATENFTVNVDNASIVVPFGVGRRSCPGKRFVEMEVVLLLAKMVLAFDVS---FVKPLETEF 521

Human   492 RTVLVPERSINLQFLDR 508
            ..:|.|:..::|:..||
  Fly   522 EFLLAPKTPLSLRLSDR 538

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP27B1NP_000776.1 p450 41..505 CDD:278495 123/511 (24%)
shdNP_001261843.1 p450 63..528 CDD:299894 121/504 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0159
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D185685at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.