DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP27B1 and Cyp12d1-p

DIOPT Version :9

Sequence 1:NP_000776.1 Gene:CYP27B1 / 1594 HGNCID:2606 Length:508 Species:Homo sapiens
Sequence 2:NP_001286304.1 Gene:Cyp12d1-p / 246648 FlyBaseID:FBgn0050489 Length:521 Species:Drosophila melanogaster


Alignment Length:504 Identity:128/504 - (25%)
Similarity:222/504 - (44%) Gaps:64/504 - (12%)


- Green bases have known domain annotations that are detailed below.


Human    39 DIPGPSTPSFLAELFCKGGLSRLHELQVQGAA----------HFGPV-----------WLASFGT 82
            :||.|:...|: ..|..||       :.|.|:          .:|.:           |:.:|.|
  Fly    44 EIPRPNKFKFM-RAFMPGG-------EFQNASITEYTSAMRKRYGDIYVMPGMFGRKDWVTTFNT 100

Human    83 VRTVYVAAPALVEELLRQEGPRPER---CSFSPWTEHRR--CRQRACGLLTAEGEEWQRLRSLLA 142
            ..         :|.:.|.||..|.|   .|...:.||.|  ......||:.::.|.|.:|||.:.
  Fly   101 KD---------IEMVFRNEGIWPRRDGLDSIVYFREHVRPDVYGEVQGLVASQNEAWGKLRSAIN 156

Human   143 PLLLRPQAAARYAGTLNNVVCDLVRRLRRQRGRGTGPPAL--VRDVAGEFYKFGLEGIAAVLLGS 205
            |:.::|:....|...|:|:..:.:.|::..|    .|..|  ..|...|..:...|.:..|....
  Fly   157 PIFMQPRGLRMYYEPLSNINNEFIERIKEIR----DPKTLEVPEDFTDEISRLVFESLGLVAFDR 217

Human   206 RLGCL-EAQVPPDTETFIRAVGSVFVSTLLTMAMPHWLRHLVPGPWGRLCRDWDQMFAFAQRHVE 269
            ::|.: :.:...|..|..:....:|..|......|...:.:....:.::.|..:.....||:.: 
  Fly   218 QMGLIRKNRDNSDALTLFQTSRDIFRLTFKLDIQPSMWKIISTPTYRKMKRTLNDSLNVAQKML- 281

Human   270 RREAEAAMRNGGQPEKDLESGAHLTHFLFREELPAQSILGNVTELLLAGVDTVSNTLSWALYELS 334
             :|.:.|:....|..:.:.|.:.|...:  |..|..:::.:: ::|.||||..:..||..|..||
  Fly   282 -KENQDALEKRRQAGEKINSNSMLERLM--EIDPKVAVIMSL-DILFAGVDATATLLSAVLLCLS 342

Human   335 RHPEVQTALHSEITAALSPGSSAYPSATVLSQLPLLKAVVKEVLRLYPVVPGNSRVPDKDIHVGD 399
            :||:.|..|..|: .::.|...:..:...:..:|.|:||:||.||.||...|..|....|:.:..
  Fly   343 KHPDKQAKLREEL-LSIMPTKDSLLNEENMKDMPYLRAVIKETLRYYPNGLGTMRTCQNDVILSG 406

Human   400 YIIPKNTLVTLCHYATSRDPAQFPEPNSFRPARWL-----GEGPTPHPFASLPFGFGKRSCMGRR 459
            |.:||.|.|.|......::...:|.|:.|.|.|||     |:.....||..||||||.|.|:|:|
  Fly   407 YRVPKGTTVLLGSNVLMKEATYYPRPDEFLPERWLRDPETGKKMQVSPFTFLPFGFGPRMCIGKR 471

Human   460 LAELELQMALAQILTHFEVQPEPGAAPVRP-KTRTVLVPERSINLQFLD 507
            :.:||::..:|:::.:|.|:....|:  || ||..|:.|..:...:|.|
  Fly   472 VVDLEMETTVAKLIRNFHVEFNRDAS--RPFKTMFVMEPAITFPFKFTD 518

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP27B1NP_000776.1 p450 41..505 CDD:278495 125/498 (25%)
Cyp12d1-pNP_001286304.1 p450 70..508 CDD:299894 116/458 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 194 1.000 Domainoid score I3171
eggNOG 1 0.900 - - E2759_KOG0159
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 201 1.000 Inparanoid score I3768
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48087
OrthoDB 1 1.010 - - D185685at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8467
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X156
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.880

Return to query results.
Submit another query.