DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idh3g and Idh3b

DIOPT Version :9

Sequence 1:NP_032349.1 Gene:Idh3g / 15929 MGIID:1099463 Length:393 Species:Mus musculus
Sequence 2:NP_001163682.1 Gene:Idh3b / 42586 FlyBaseID:FBgn0038922 Length:370 Species:Drosophila melanogaster


Alignment Length:366 Identity:188/366 - (51%)
Similarity:247/366 - (67%) Gaps:25/366 - (6%)


- Green bases have known domain annotations that are detailed below.


Mouse    34 APRRSISSQQTIPPSAKYG-GRHTVTMIPGDGIGPELMLHVKSVFRHACVPVDFE-----EVHVS 92
            |..||:.:..|:..:..|| .|.|.|:|||||:||||:..::.||:.|.||||||     |::..
  Fly    16 AAARSLHTTSTLRATDNYGANRTTCTLIPGDGVGPELVYSLQEVFKAASVPVDFECYFLSEINPV 80

Mouse    93 SNADEEDIRNAIMAIRRNRVALKGNIETNHNLPPSH------KSRNNILRTSLDLYANVIHCKSL 151
            .:|..||:   :.:|::|:|.:||.:.|     |.:      ::.|..||..|||||||:|.:||
  Fly    81 LSAKLEDV---VASIQKNKVCIKGVLAT-----PDYSNVGDLQTLNMKLRNDLDLYANVVHVRSL 137

Mouse   152 PGVVTRHKDIDILIVRENTEGEYSSLEHESVAGVVESLKIITKAKSLRIAEYAFKLAQESGRKKV 216
            |||.|||.:||.:|:||.||||||:||||||.|:||.|||||..||:|||::||..|.::.||||
  Fly   138 PGVKTRHTNIDTVIIREQTEGEYSALEHESVPGIVECLKIITAKKSMRIAKFAFDYATKNQRKKV 202

Mouse   217 TAVHKANIMKLGDGLFLQCCREVAAHYPQITFDSMIVDNTTMQLVSRPQQFDVMVMPNLYGNIVN 281
            |||||||||||||||||:.|.||:..||:|.|:.|||||||||:||.|.||||||.|||||.||:
  Fly   203 TAVHKANIMKLGDGLFLRSCEEVSRLYPRIQFEKMIVDNTTMQMVSNPNQFDVMVTPNLYGAIVD 267

Mouse   282 NVCAGLVGGPGLVAGANYGHVYAVFETATRNTGKSIANKNIANPTATLLASCMMLDHLKLHSYAT 346
            |:.:|||||.|:||||:|.....|||...|:|......||:|||||.||....:|.|:.|.:|..
  Fly   268 NLASGLVGGAGVVAGASYSSESVVFEPGARHTFAEAVGKNVANPTAMLLCGVKLLRHINLPTYGE 332

Mouse   347 SIRKAVLASMDNENMHTPDIGGQGTTSQAIQDIIRHIRIIN 387
            .|:.|:...:::..:.|.|:|||.||    ||..|.| |:|
  Fly   333 IIQNAINKVLNDGKVRTKDLGGQSTT----QDFTRAI-ILN 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Idh3gNP_032349.1 mito_nad_idh 52..383 CDD:272942 180/342 (53%)
Idh3bNP_001163682.1 Iso_dh 37..369 CDD:294303 182/345 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0473
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53770
OrthoDB 1 1.010 - - D325037at33208
OrthoFinder 1 1.000 - - FOG0000244
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101342
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R585
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.760

Return to query results.
Submit another query.