DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP26A1 and Cyp9c1

DIOPT Version :9

Sequence 1:NP_000774.2 Gene:CYP26A1 / 1592 HGNCID:2603 Length:497 Species:Homo sapiens
Sequence 2:NP_523850.1 Gene:Cyp9c1 / 37941 FlyBaseID:FBgn0015040 Length:522 Species:Drosophila melanogaster


Alignment Length:548 Identity:114/548 - (20%)
Similarity:199/548 - (36%) Gaps:135/548 - (24%)


- Green bases have known domain annotations that are detailed below.


Human    18 LLLFLAAIKL----WDLYC---VSGRDRSCALPLPPGTMGFPFFGETLQMVLQRRK--------- 66
            |.:|:|.|.|    |.:|.   .|.|..:...|:       |..|.....||..::         
  Fly     6 LSIFVAFIGLLLYKWSVYTFGYFSKRGVAHEKPI-------PLLGNIPWSVLMGKESYIKHSIDL 63

Human    67 FLQMKRRKYGFIYKTHLFGRPTVRVMGADNVRRILLGEHRLVSVHWPASVR----TILGSGCLSN 127
            .|::|:.|   :|.......|...:...:.:|::.:......:.|......    |.:.|..|.:
  Fly    64 HLRLKQHK---VYGVFNLRDPLYYLSDPELIRQVGIKNFDTFTNHRKGITEGFNDTSVISKSLLS 125

Human   128 LHDSSHKQRKKVIMRAFS----REALE----CYVPVITEEVGSSLEQWLSCGERGLLVYPEVKRL 184
            |.|...||.:..:...|:    |:..|    |.|     |....:::.|..|...|    |:|..
  Fly   126 LRDRRWKQMRSTLTPTFTSLKIRQMFELIHFCNV-----EAVDFVQRQLDAGTSEL----ELKDF 181

Human   185 MFRIAMRIL----LGCEPQLAGDGDSEQQLVEAFEEMTRNLFSLPIDVPFSGLYRGMKAR-NLIH 244
            ..|....::    .|.:             |.:|::.....||:...:.....:.|:|.. .::.
  Fly   182 FTRYTNDVIATAAFGIQ-------------VNSFKDPNNEFFSIGQRISEFTFWGGLKVMLYILM 233

Human   245 ARIEQNIRAKICGLR---------------ASEAGQGCKDALQLLIEHSWERGERLDMQALKQSS 294
            .::.:.:|..:..:.               ..|......|.:.||:|.  :|..:.:.:...:|:
  Fly   234 PKLMKALRVPVMDMNNVDYFKKLVFGAMKYRKEQSIVRPDMIHLLMEA--QRQFKAEQEGSAESA 296

Human   295 TE---------------LLF--GGHETTASAATSLITYLGLYPHVLQKVREELKSKGLLCKSNQD 342
            .:               |||  .|.||.|:..:.....|.:.|.|.:|:..|:    |..|....
  Fly   297 AQQDKAEFNDDDLLAQCLLFFSAGFETVATCLSFTSYELMMNPEVQEKLLAEI----LAVKEQLG 357

Human   343 NK-LDMEILEQLKYIGCVIKETLRLNPPVPGGFRVALKTFELNGYQIPKGWNVI---------YS 397
            .| ||.:.|..:||:.||:.|:||..||.....|:....|:|..   .:|..|:         .:
  Fly   358 EKPLDYDTLMGMKYLNCVVSESLRKWPPAFIVDRMCGSDFQLKD---EEGEVVVNLREDDLVHIN 419

Human   398 ICDTHDVAEIFTNKEEFNPDRFMLPHPEDASRFSFIPFGGGLRSCVGKEFAKILLK--IFTVELA 460
            :...|...:.|...|:|.|:||...|..:..:|:::|||.|.|||:|...|.:.:|  ||.:.|.
  Fly   420 VGALHHDPDNFPEPEQFRPERFDEEHKHEIRQFTYLPFGVGQRSCIGNRLALMEVKSLIFQLVLR 484

Human   461 RHCDWQLLNGPPTMKTSPTVYPVDNLPA 488
            .|                 :.|.|..||
  Fly   485 YH-----------------LKPTDRTPA 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP26A1NP_000774.2 p450 14..492 CDD:299894 114/548 (21%)
Cyp9c1NP_523850.1 p450 37..514 CDD:299894 105/517 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2429
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.