DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP26A1 and Cyp6a14

DIOPT Version :9

Sequence 1:NP_000774.2 Gene:CYP26A1 / 1592 HGNCID:2603 Length:497 Species:Homo sapiens
Sequence 2:NP_001286199.1 Gene:Cyp6a14 / 35835 FlyBaseID:FBgn0033302 Length:509 Species:Drosophila melanogaster


Alignment Length:545 Identity:124/545 - (22%)
Similarity:207/545 - (37%) Gaps:146/545 - (26%)


- Green bases have known domain annotations that are detailed below.


Human     6 LLASALCTFVLPLLLFLAAIKLWDLYCVSGRDRSCALPLPPGTMGFPFFGETLQMVLQRRKFLQM 70
            |...||...||.|...| .||::..:...|......||:.....|          ::::..|..:
  Fly     2 LFTIALVGVVLGLAYSL-HIKIFSYWKRKGVPHETPLPIVGNMRG----------IVKKYHFRDI 55

Human    71 KRRKY------GFIYKTHLFGRPTVRVMGADNVRRILLGE----------------------HRL 107
            .:|.|      |.|...::|.:.|..:...|.::::::.:                      ..|
  Fly    56 NQRIYKKFKGQGPIAGMYMFFKRTALITDLDFIKQVMIKDFSYFQDRGAFTNPRDDPLTGHLFAL 120

Human   108 VSVHWPA---SVRTILGSGCLSNLHDSSHKQRKKVIMRAFSR--EALECYVPVITEEVGSSLEQW 167
            ....|.|   .:..:..||.:        ||..|||:....|  :|::..|.....|.|:     
  Fly   121 EGEEWRAMRHKLTPVFTSGKI--------KQMSKVIVDVGLRLGDAMDKAVKEAKVEEGN----- 172

Human   168 LSCGERGLLVYPEVKRLMFRIAMRILLGCEPQLAGDGDSEQQLVEAFEEMTRNLFS--------- 223
                       .|:|.|..|....::..|...|  :.:|.|.....|.:..|.:|:         
  Fly   173 -----------VEIKDLCARFTTDVIGSCAFGL--ECNSLQDPSAEFRQKGREIFTRRRHSTLVQ 224

Human   224 -----------------LPIDVP--FSG---------LYRGMKARNLIHARIEQNIRAKICGLRA 260
                             ||.|:.  |..         |..|:|..:.|...||  :||:  ...|
  Fly   225 SFIFTNARLARKLRIKVLPDDLTQFFMSTVKNTVDYRLKNGIKRNDFIEQMIE--LRAE--DQEA 285

Human   261 SEAGQGCKDALQLLIEHSWERGERLDMQALKQSSTELLFGGHETTASAATSLITYLGLYPHVLQK 325
            ::.|||      :.:.|.      |.::.:...:......|.||::|..:..:..|.|.|.:.|:
  Fly   286 AKKGQG------IDLSHG------LTLEQMAAQAFVFFVAGFETSSSTMSLCLYELALQPDIQQR 338

Human   326 VREELKSKGLLCKSNQD-NKLDMEILEQLKYIGCVIKETLRLNPPVPGGFRVALKTFELNGYQIP 389
            :|||::|    ..:|.| .:|:.::|.|:.|:..|:.||||.:|.:|...|...|     .||||
  Fly   339 LREEIES----VLANVDGGELNYDVLAQMTYLDQVLSETLRKHPLLPHLIRETTK-----DYQIP 394

Human   390 -------KGWNVIYSICDTHDVAEIFTNKEEFNPDRFMLPHPEDASR---FSFIPFGGGLRSCVG 444
                   ||...:..:.:.|...||:...|:|:|.||   .||:...   .:::|||.|.|:|:|
  Fly   395 NSDIVLDKGILALIPVHNIHHDPEIYPEPEKFDPSRF---DPEEVKNRHPMAYLPFGDGPRNCIG 456

Human   445 KEFAKILLKIFTVELARHCDWQLLN 469
            ..|.||..||..|.|.|...:.:.|
  Fly   457 LRFGKIQAKIGLVSLLRRFKFSVSN 481

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP26A1NP_000774.2 p450 14..492 CDD:299894 121/537 (23%)
Cyp6a14NP_001286199.1 p450 32..506 CDD:306555 114/514 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2429
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.