DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP26A1 and Cyp4ac3

DIOPT Version :9

Sequence 1:NP_000774.2 Gene:CYP26A1 / 1592 HGNCID:2603 Length:497 Species:Homo sapiens
Sequence 2:NP_608918.1 Gene:Cyp4ac3 / 33756 FlyBaseID:FBgn0031695 Length:509 Species:Drosophila melanogaster


Alignment Length:374 Identity:86/374 - (22%)
Similarity:165/374 - (44%) Gaps:49/374 - (13%)


- Green bases have known domain annotations that are detailed below.


Human   116 VRTILGSGCLSNLHDSSHKQRKKVIMRAFSREALECYVPVITEEVGSSLEQWLSCGERGLLVYPE 180
            :|..||.|.|.::....| .|:|.:..||....|:.::.:..||    .::::...::.:....|
  Fly   123 IRPFLGDGLLISIDQKWH-TRRKTLTPAFHFNILQSFLSIFKEE----SKKFIKILDKNVGFELE 182

Human   181 VKRLMFRIAMRILLGCEPQLA------GDGDSEQQLVEAFEEMTRNLFSLPIDVPFSGLY----- 234
            :.:::.:..:..:  ||..|.      .:|:..::.:..||.:.......|:  .|...|     
  Fly   183 LNQIIPQFTLNNI--CETALGVKLDDMSEGNEYRKAIHDFEIVFNQRMCNPL--MFFNWYFFLFG 243

Human   235 ---RGMKARNLIHA-------RIEQNIRAKICGLRASEAGQGCKDA-LQLLIEHSWERGERLDMQ 288
               :..:....||.       |..|..:.|..| :..|.|:..:.| |..|:  :.|...::|.|
  Fly   244 DYKKYSRILRTIHGFSSGIIQRKRQQFKQKQLG-QVDEFGKKQRYAMLDTLL--AAEAEGKIDHQ 305

Human   289 ALKQSSTELLFGGHETTASAATSLITYLGLYPHVLQKVREELKSKGLLCKSNQD-----NKLDME 348
            .:.......:|||::||:::....:..|.|:..|.::..|||          ||     :::.|.
  Fly   306 GICDEVNTFMFGGYDTTSTSLIFTLLLLALHADVQERCYEEL----------QDLPEDIDEVSMF 360

Human   349 ILEQLKYIGCVIKETLRLNPPVPGGFRVALKTFELNGYQIPKGWNVIYSICDTHDVAEIFTNKEE 413
            ...:|.::.|||||:|||.|..|...|..::...:||..:||...:...|.|....|..|....:
  Fly   361 QFNELIHLECVIKESLRLFPSAPIIGRTCIEESVMNGLVLPKNAQISIHIYDIMRDARHFPKPNQ 425

Human   414 FNPDRFMLPHPEDASRFSFIPFGGGLRSCVGKEFAKILLKIFTVELARH 462
            |.|:||:..:..:...|:|:||..|.|:|:|::|..:.:|:....:.|:
  Fly   426 FLPERFLPENSVNRHPFAFVPFSAGPRNCIGQKFGVLEIKVLLAAVIRN 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP26A1NP_000774.2 p450 14..492 CDD:299894 86/374 (23%)
Cyp4ac3NP_608918.1 p450 51..504 CDD:278495 86/374 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.