DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP26A1 and Cyp4d1

DIOPT Version :9

Sequence 1:NP_000774.2 Gene:CYP26A1 / 1592 HGNCID:2603 Length:497 Species:Homo sapiens
Sequence 2:NP_476907.2 Gene:Cyp4d1 / 31188 FlyBaseID:FBgn0005670 Length:512 Species:Drosophila melanogaster


Alignment Length:531 Identity:131/531 - (24%)
Similarity:216/531 - (40%) Gaps:107/531 - (20%)


- Green bases have known domain annotations that are detailed below.


Human     5 ALLASALCTFVLPLLLFLAAIKLWDLYCVSGRDRSCALPLPPGTMGFPFFGETLQMVLQRRKFLQ 69
            |:|||||  ||..||..|...:|.||           :...||....|..|              
  Fly     7 AILASAL--FVGLLLYHLKFKRLIDL-----------ISYMPGPPVLPLVG-------------- 44

Human    70 MKRRKYGFIYKTHLFGRPT----------VRVMGADNVRRILLGEHRLVSVHWPASVRTILGS-- 122
                     :..|..|:|.          :.....|.|.::.||....|.:..|..|..:||:  
  Fly    45 ---------HGHHFIGKPPHEMVKKIFEFMETYSKDQVLKVWLGPELNVLMGNPKDVEVVLGTLR 100

Human   123 -----------------GCLSNLHDSSHKQRKKVIMRAFSREALECYVPVITEEVGS-----SLE 165
                             |.|.:.....|| |:|:|..||..:.|:.:|.|.  |.||     ::|
  Fly   101 FNDKAGEYKALEPWLKEGLLVSRGRKWHK-RRKIITPAFHFKILDQFVEVF--EKGSRDLLRNME 162

Human   166 Q-WLSCGERGLLVYPEVKRLMFRIAMRILLGCEPQLAGDGDSEQ-QLVEAF-----EEMTRNLFS 223
            | .|..|:.|..:|..:............:|.......:.|||. |.|:..     :.|...|:.
  Fly   163 QDRLKHGDSGFSLYDWINLCTMDTICETAMGVSINAQSNADSEYVQAVKTISMVLHKRMFNILYR 227

Human   224 LPIDVPFSGLYRG-MKARNLIHARIEQNI---RAKICGLRASEAGQGCKD-----------ALQL 273
            ..:....:.|.|. .||.|::|...|:.|   |.::  :|...:.:...|           .|.:
  Fly   228 FDLTYMLTPLARAEKKALNVLHQFTEKIIVQRREEL--IREGSSQESSNDDADVGAKRKMAFLDI 290

Human   274 LIEHSWERGER-LDMQALKQSSTELLFGGHETTASAATSLITYLGLYPHVLQKVREELKSKGLLC 337
            |::.:.:  || |....:::.....:|.||:||:||.......:..:|...:|..||::|   :.
  Fly   291 LLQSTVD--ERPLSNLDIREEVDTFMFEGHDTTSSALMFFFYNIATHPEAQKKCFEEIRS---VV 350

Human   338 KSNQDNKLDMEILEQLKYIGCVIKETLRLNPPVPGGFRVALKTFELNGYQIPKGWNVIYSICDTH 402
            .:::...:..|:|.||.|:...:|||||:.|.||...|..|:..|:||..||.|.|:..|.....
  Fly   351 GNDKSTPVSYELLNQLHYVDLCVKETLRMYPSVPLLGRKVLEDCEINGKLIPAGTNIGISPLYLG 415

Human   403 DVAEIFTNKEEFNPDRF-MLPHPEDASRFSFIPFGGGLRSCVGKEFAKILLKIFTVELARHCDWQ 466
            ...|:|:....|.|:|| ::...|..:.:::|||..|.|:|:|::||.:.:|.....:.||.:..
  Fly   416 RREELFSEPNIFKPERFDVVTTAEKLNPYAYIPFSAGPRNCIGQKFAMLEIKAIVANVLRHYEVD 480

Human   467 LL---NGPPTM 474
            .:   :.||.:
  Fly   481 FVGDSSEPPVL 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP26A1NP_000774.2 p450 14..492 CDD:299894 125/522 (24%)
Cyp4d1NP_476907.2 p450 35..507 CDD:278495 117/490 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.