DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP26A1 and Cyp4g1

DIOPT Version :9

Sequence 1:NP_000774.2 Gene:CYP26A1 / 1592 HGNCID:2603 Length:497 Species:Homo sapiens
Sequence 2:NP_525031.1 Gene:Cyp4g1 / 30986 FlyBaseID:FBgn0010019 Length:556 Species:Drosophila melanogaster


Alignment Length:550 Identity:133/550 - (24%)
Similarity:212/550 - (38%) Gaps:141/550 - (25%)


- Green bases have known domain annotations that are detailed below.


Human     8 ASALCTFVL---PLLL----FLAAIKLWDLYCVSGRD-RSCA-LPLPPGTMGFPFFGET-LQMVL 62
            ||:..|.||   |:|.    .|.|:.|::.:..:.|: |..| :|.||   ..|..|:. :...|
  Fly    14 ASSSSTTVLGFSPMLTTLVGTLVAMALYEYWRRNSREYRMVANIPSPP---ELPILGQAHVAAGL 75

Human    63 QRRKFLQM---KRRKYGFIYKTHLFGRPTVRVMGADNVRRILLGEHRLVSVHWPASVRTILGSGC 124
            ...:.|.:   ...|||...|..|.....|.:....::..||.|...|.........:...|.|.
  Fly    76 SNAEILAVGLGYLNKYGETMKAWLGNVLLVFLTNPSDIELILSGHQHLTKAEEYRYFKPWFGDGL 140

Human   125 L-SNLHDSSHKQRKKVIMRAFSREALECYVPVITE-----------EVGSSLE--QWLS------ 169
            | ||.|...|  .:|:|...|.:..|:.:||...:           |.|.|.:  .::|      
  Fly   141 LISNGHHWRH--HRKMIAPTFHQSILKSFVPTFVDHSKAVVARMGLEAGKSFDVHDYMSQTTVDI 203

Human   170 -----CGERGL------------------LVYPEVKRLMFRI---------------AMRILLGC 196
                 .|.:.|                  :::....:|::|:               .|.|:||.
  Fly   204 LLSTAMGVKKLPEGNKSFEYAQAVVDMCDIIHKRQVKLLYRLDSIYKFTKLREKGDRMMNIILGM 268

Human   197 EPQLAGDGDSEQQLVEAFEEMTRNLFSLPIDVPFSGLYRGMKARNLIHARIEQNIRAKICGLR-- 259
            ..::..|..      |.|:|.:|.:.. .|..|.:......|.                 |||  
  Fly   269 TSKVVKDRK------ENFQEESRAIVE-EISTPVASTPASKKE-----------------GLRDD 309

Human   260 ---ASEAGQGCKDALQLL-----------IEHSWERGERLDMQALKQSSTELLFGGHETTASAAT 310
               ..|...|.|..|.||           ||  |...:.:|      ....::|.||:||::.::
  Fly   310 LDDIDENDVGAKRRLALLDAMVEMAKNPDIE--WNEKDIMD------EVNTIMFEGHDTTSAGSS 366

Human   311 SLITYLGLYPHVLQKVREELKSKGLLCKSNQDNKL-DMEILE--QLKYIGCVIKETLRLNPPVPG 372
            ..:..:|::..:..||..|.|:      ...||.| |....:  ::||:..||.|||||.|||| 
  Fly   367 FALCMMGIHKDIQAKVFAEQKA------IFGDNMLRDCTFADTMEMKYLERVILETLRLYPPVP- 424

Human   373 GFRVALK-TFEL----NGYQIPKGWNVIYSICDTHDVAEIFTNKEEFNPDRFMLPHPEDASRFSF 432
              .:|.: .::|    ..|.:|||..||......|...:|:.|..:|:||.|:.....:...:||
  Fly   425 --LIARRLDYDLKLASGPYTVPKGTTVIVLQYCVHRRPDIYPNPTKFDPDNFLPERMANRHYYSF 487

Human   433 IPFGGGLRSCVGKEFAKILLKIFTVELARH 462
            |||..|.|||||:::|.:.||:....:.|:
  Fly   488 IPFSAGPRSCVGRKYAMLKLKVLLSTIVRN 517

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP26A1NP_000774.2 p450 14..492 CDD:299894 130/543 (24%)
Cyp4g1NP_525031.1 p450 58..518 CDD:278495 120/505 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.