DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP24A1 and Cyp4ac2

DIOPT Version :10

Sequence 1:NP_000773.2 Gene:CYP24A1 / 1591 HGNCID:2602 Length:514 Species:Homo sapiens
Sequence 2:NP_608917.3 Gene:Cyp4ac2 / 33755 FlyBaseID:FBgn0031694 Length:511 Species:Drosophila melanogaster


Alignment Length:33 Identity:10/33 - (30%)
Similarity:16/33 - (48%) Gaps:1/33 - (3%)


- Green bases have known domain annotations that are detailed below.


Human     4 KLALGEIAGFSQAKLKKTKTHEQDNLPTKETIE 36
            |:.|..:..::.| |||.:.|:....|...|.|
  Fly   596 KVNLARVDLYANA-LKKLQLHQLRVAPAPPTTE 627

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP24A1NP_000773.2 CYP24A1 90..508 CDD:410738
Cyp4ac2NP_608917.3 CYP4 84..503 CDD:410721
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.