DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Id4 and emc

DIOPT Version :9

Sequence 1:NP_112443.1 Gene:Id4 / 15904 MGIID:99414 Length:161 Species:Mus musculus
Sequence 2:NP_523876.2 Gene:emc / 38091 FlyBaseID:FBgn0000575 Length:199 Species:Drosophila melanogaster


Alignment Length:48 Identity:27/48 - (56%)
Similarity:37/48 - (77%) Gaps:0/48 - (0%)


- Green bases have known domain annotations that are detailed below.


Mouse    67 DMNDCYSRLRRLVPTIPPNKKVSKVEILQHVIDYILDLQLALETHPAL 114
            :|....|:|:.|||.:|.|:|::|:||:|||||||.|||..|||||.:
  Fly    38 EMKMYLSKLKDLVPFMPKNRKLTKLEIIQHVIDYICDLQTELETHPEM 85

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Id4NP_112443.1 bHLH_dnHLH_ID4 62..117 CDD:381537 27/48 (56%)
emcNP_523876.2 HLH <37..80 CDD:238036 22/41 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834119
Domainoid 1 1.000 55 1.000 Domainoid score I11057
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1624054at2759
OrthoFinder 1 1.000 - - FOG0000920
OrthoInspector 1 1.000 - - otm43424
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11723
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4557
SonicParanoid 1 1.000 - - X1045
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.940

Return to query results.
Submit another query.