powered by:
Protein Alignment Id1 and tap
DIOPT Version :9
Sequence 1: | NP_001355947.1 |
Gene: | Id1 / 15901 |
MGIID: | 96396 |
Length: | 168 |
Species: | Mus musculus |
Sequence 2: | NP_524124.1 |
Gene: | tap / 39935 |
FlyBaseID: | FBgn0015550 |
Length: | 398 |
Species: | Drosophila melanogaster |
Alignment Length: | 50 |
Identity: | 15/50 - (30%) |
Similarity: | 31/50 - (62%) |
Gaps: | 0/50 - (0%) |
- Green bases have known domain annotations that are detailed below.
Mouse 59 LYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEV 108
::::|....:|:..:|:||:..|::|:|||:...:||..|:..|.|...:
Fly 167 MHNLNDALEKLRVTLPSLPEETKLTKIEILRFAHNYIFALEQVLESGGSI 216
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.