DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ibsp and CG1647

DIOPT Version :9

Sequence 1:NP_032344.2 Gene:Ibsp / 15891 MGIID:96389 Length:324 Species:Mus musculus
Sequence 2:NP_651636.1 Gene:CG1647 / 43401 FlyBaseID:FBgn0039602 Length:1222 Species:Drosophila melanogaster


Alignment Length:326 Identity:67/326 - (20%)
Similarity:103/326 - (31%) Gaps:114/326 - (34%)


- Green bases have known domain annotations that are detailed below.


Mouse    74 DSSEEEGEEEETSNEEENNE------DSEGNEDQEAEAENSTLSTLSGVTA-----SYGAETTPQ 127
            |:....|:.|.....|.|.|      |.:...|:..|.:..|.|....|.|     |...:..|:
  Fly   460 DTGPPRGQAESDPEPERNEEHPSFGDDIQAANDECQECQPETESDKISVAACDDIPSVSVKQEPE 524

Mouse   128 AQTFELAA----------LQLPK--------------KAGDAESRAPKVKESDEEEEEEEEEEEN 168
            ...:|...          |::.|              :||.|..|:.| |:...:.:|.|:|..|
  Fly   525 YDGYEKQTGVKQEPLKLKLKITKNHGKLNSSLIDDLDEAGQAFGRSSK-KKKKRKHKEREKEASN 588

Mouse   169 ENEEAEVD-ENELAVN---------------------------GTSTNSTEVDG----------- 194
            |.|....: :|:.|:.                           ..|..|.|||.           
  Fly   589 ETENCRTESQNQPAIKIKQEPVDYAPEATVMTTIPMTQFESSLNESERSEEVDEAMIQSQEDVKP 653

Mouse   195 -----------GNGSSGGDNGEEA----EAEEA---------SVTEAGAEGTTGGRE-------L 228
                       .|.:||.|..|||    .||||         ...::.|..:|||.|       .
  Fly   654 NRMELDRMMQISNVTSGVDMAEEAMALERAEEACPEDSLHKVKSVKSTARKSTGGAERKTYSPPR 718

Mouse   229 TSVGTQTAVLLNG---FQQTTPPPE----AYGTTSPPIRKSSTVEYG-GEYEQTGNEYNNEYEVY 285
            |:...|...:::|   |...:..||    .||...|..::.:|.|.. .:..:...||....::.
  Fly   719 TNTLPQIVAVVSGESAFNMISIKPEPRNLGYGDEEPEDQRETTEEINHNDMMEEEKEYIGSLDLS 783

Mouse   286 D 286
            |
  Fly   784 D 784

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IbspNP_032344.2 BSP_II 17..321 CDD:283165 67/326 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 60..228 53/258 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 243..263 5/23 (22%)
Cell attachment site. /evidence=ECO:0000255 293..295
CG1647NP_651636.1 zf-AD 19..99 CDD:285071
C2H2 Zn finger 203..224 CDD:275368
C2H2 Zn finger 233..253 CDD:275368
C2H2 Zn finger 262..282 CDD:275368
C2H2 Zn finger 297..314 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1181
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.