DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ibsp and Cp190

DIOPT Version :9

Sequence 1:NP_032344.2 Gene:Ibsp / 15891 MGIID:96389 Length:324 Species:Mus musculus
Sequence 2:NP_524359.2 Gene:Cp190 / 41848 FlyBaseID:FBgn0000283 Length:1096 Species:Drosophila melanogaster


Alignment Length:206 Identity:54/206 - (26%)
Similarity:79/206 - (38%) Gaps:56/206 - (27%)


- Green bases have known domain annotations that are detailed below.


Mouse    65 DSSEENGDGDSSEEEGEEEETSNEE---------ENNEDSEGNEDQEAEAENSTLSTLSGVTASY 120
            :|..|..|.||   |..:|:.|..|         ||:::....||......:|.......||||.
  Fly   878 NSQPEKMDVDS---EAADEKASKAEVQIKKEAELENDQEEFIKEDSPIPHSDSVAELREAVTASE 939

Mouse   121 GAETTPQAQTFELAALQLPKKAGD---AESRAPKVKESDEEEEEEEEEEENENEEA----EVDEN 178
            |.:..      .|.|..:.|:..|   ||:..|      ::|::..:.|||...||    ..||:
  Fly   940 GEDDV------HLEADNIRKELLDELIAEAEKP------DQEKDIVQSEENATTEALDRSVTDED 992

Mouse   179 ELA-VNGTSTNSTEVDGGNGSSGGDNGEE---AEAEEA---------SVT----------EAGAE 220
            :|. ....||...|:|........:|.|:   |:.:||         .||          :||.|
  Fly   993 DLVPPTQVSTEQMEIDEPAAEKAAENNEDTRTADEKEAVEDKPNQTQDVTTAEKPTLESAKAGDE 1057

Mouse   221 GTTGGRELTSV 231
            .|:|  |..||
  Fly  1058 ATSG--EAASV 1066

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IbspNP_032344.2 BSP_II 17..321 CDD:283165 54/206 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 60..228 51/201 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 243..263
Cell attachment site. /evidence=ECO:0000255 293..295
Cp190NP_524359.2 BTB 20..122 CDD:279045
BTB 31..127 CDD:197585
C2H2 Zn finger 540..568 CDD:275371
C2H2 Zn finger 569..586 CDD:275371
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1181
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.