Sequence 1: | NP_659406.1 | Gene: | ZDHHC15 / 158866 | HGNCID: | 20342 | Length: | 337 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_651539.3 | Gene: | CG5880 / 43268 | FlyBaseID: | FBgn0039489 | Length: | 381 | Species: | Drosophila melanogaster |
Alignment Length: | 257 | Identity: | 74/257 - (28%) |
---|---|---|---|
Similarity: | 111/257 - (43%) | Gaps: | 80/257 - (31%) |
- Green bases have known domain annotations that are detailed below.
Human 127 AVRFCDRCHLIKPDRCHHCSVCAMCVLKMDHHCPWVNNCIGFSNYKFFLQFLAYSVLYCLYIATT 191
Human 192 VFSYFIKY-W--RGE-------LPSVRSKF----HVL----------FLLFVA------------ 220
Human 221 --------CMFF-----VSLVILFG----YHCWLVSRNKTTLEAFCTPVFTSGPEK--------- 259
Human 260 -NGFNLGFIKNIQQVFG--DKKKFW---LIPIGSSP-GDGHSFPMRSMNESQNPLLANEETW 314 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ZDHHC15 | NP_659406.1 | zf-DHHC | <126..308 | CDD:327686 | 72/249 (29%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 306..337 | 3/9 (33%) | |||
CG5880 | NP_651539.3 | zf-DHHC | 139..>201 | CDD:279823 | 30/61 (49%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5273 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 1 | 1.010 | - | - | QHG55511 | |
OrthoDB | 1 | 1.010 | - | - | D1491968at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.830 |