DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZDHHC15 and CG5880

DIOPT Version :9

Sequence 1:NP_659406.1 Gene:ZDHHC15 / 158866 HGNCID:20342 Length:337 Species:Homo sapiens
Sequence 2:NP_651539.3 Gene:CG5880 / 43268 FlyBaseID:FBgn0039489 Length:381 Species:Drosophila melanogaster


Alignment Length:257 Identity:74/257 - (28%)
Similarity:111/257 - (43%) Gaps:80/257 - (31%)


- Green bases have known domain annotations that are detailed below.


Human   127 AVRFCDRCHLIKPDRCHHCSVCAMCVLKMDHHCPWVNNCIGFSNYKFFLQFLAYSVLYCLYIATT 191
            ||..|.:|...||.|.||||:|..|:|||||||||:|||:|:.|:::|..::.|:.|.||::...
  Fly   135 AVSMCGKCIAPKPPRTHHCSICNRCILKMDHHCPWLNNCVGYGNHRYFFLYMTYTTLGCLFLILF 199

Human   192 VFSYFIKY-W--RGE-------LPSVRSKF----HVL----------FLLFVA------------ 220
            ......|| |  .||       |.....||    |::          |:|..|            
  Fly   200 GLEIGHKYLWLDHGENWTEIEPLEGQPVKFNLSGHIIPVTHPNEYDEFVLPPAVHNLPTPIVDTD 264

Human   221 --------CMFF-----VSLVILFG----YHCWLVSRNKTTLEAFCTPVFTSGPEK--------- 259
                    .::|     |::|:..|    :|..|::|.:|::||.    ......|         
  Fly   265 AASPGRRRALWFMAFTNVAVVLALGSLSIWHAKLITRGETSVEAH----INEAERKRHLQQQRIY 325

Human   260 -NGFNLGFIKNIQQVFG--DKKKFW---LIPIGSSP-GDGHSFPMRSMNESQNPLLANEETW 314
             |.:|.|..||.:...|  ..:.||   |:|....| |.|.||  .::|::  |.   |:.|
  Fly   326 INPYNFGTKKNWKLFLGLVRGRSFWRTVLLPSWHKPEGTGLSF--HTVNDA--PF---EDEW 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZDHHC15NP_659406.1 zf-DHHC <126..308 CDD:327686 72/249 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 306..337 3/9 (33%)
CG5880NP_651539.3 zf-DHHC 139..>201 CDD:279823 30/61 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55511
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.