DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZDHHC15 and CG17196

DIOPT Version :9

Sequence 1:NP_659406.1 Gene:ZDHHC15 / 158866 HGNCID:20342 Length:337 Species:Homo sapiens
Sequence 2:NP_651426.1 Gene:CG17196 / 43112 FlyBaseID:FBgn0039368 Length:276 Species:Drosophila melanogaster


Alignment Length:312 Identity:69/312 - (22%)
Similarity:115/312 - (36%) Gaps:111/312 - (35%)


- Green bases have known domain annotations that are detailed below.


Human    37 YAYVFELCLVTVLSPAEKVIYLILYHAIFVFFTWTYWKSIFTLPQQPNQKFHLSYTDKERYENEE 101
            ||.::....|::..|. .||:|::   ..|||        |||     |.|:::           
  Fly    11 YANLYPKKAVSIGHPL-SVIFLLV---STVFF--------FTL-----QVFYVA----------- 47

Human   102 RPEVQKQMLVDMAKKLPVYT------------RTGSGAVR------------------FCDRCHL 136
             |:|....:........::|            || |.||:                  :||.|..
  Fly    48 -PDVHDGFMYKFFVISAIFTTYNILGNLLACYRT-SSAVKSLPQERQIPKPGTEHLWHYCDICQK 110

Human   137 IKPDRCHHCSVCAMCVLKMDHHCPWVNNCIGFSNYKFFLQ---FLAYSV--------------LY 184
            :.|.|..||::|..|:||.||||.:...|||.:|:::|..   :||:.:              .|
  Fly   111 LMPPRSWHCALCKCCILKRDHHCIFAATCIGHNNHRYFFWLTFYLAFGIFMSMATLFVDVGRSFY 175

Human   185 CLYIATTVFSYFIK---YWRGELPSVRSKFHVLFLLFVACMFFVSLVILFGYHCWLVSRNKTTLE 246
            .|:.....|...:|   |:|          :|..:|.:..:.|.:|::.|  ...::..|.|..:
  Fly   176 LLHRMKAGFGNTVKSLSYFR----------YVCLILNIFALGFPALMLRF--QVQILKLNSTYYQ 228

Human   247 AFCTPVFTSGPEKNGFNLGFIKNIQQVFGDKKKFWLI------PIGSSPGDG 292
            .          .....:|||..|.|.:.|.:..:..|      |:   |.||
  Fly   229 I----------SSRHHDLGFRNNCQLIMGQRGLWTFISPSLRSPL---PHDG 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZDHHC15NP_659406.1 zf-DHHC <126..308 CDD:327686 48/211 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 306..337
CG17196NP_651426.1 zf-DHHC 103..228 CDD:279823 35/136 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.