DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZDHHC15 and CG5196

DIOPT Version :9

Sequence 1:NP_659406.1 Gene:ZDHHC15 / 158866 HGNCID:20342 Length:337 Species:Homo sapiens
Sequence 2:NP_650191.1 Gene:CG5196 / 41522 FlyBaseID:FBgn0038039 Length:427 Species:Drosophila melanogaster


Alignment Length:327 Identity:78/327 - (23%)
Similarity:124/327 - (37%) Gaps:108/327 - (33%)


- Green bases have known domain annotations that are detailed below.


Human    17 RRVLSWVPVL---VIVLVVLWSYYAYVFELCLVTVLSPAEKVIYLILYHAIFVFF----TWTYWK 74
            ||.|.|.|:.   :|..:.|.:.|       :.::..|..|......:.|:|:..    |:.|..
  Fly     9 RRFLHWGPITALSIIKCITLTTLY-------MNSMWWPPNKSFAGFAHQALFLLLSTLATFNYVM 66

Human    75 SIFTLPQQPNQKFHLSYTDKERYENEERPEVQKQMLVDMAKKLPVYTRTGSGAVRFCDRCHLIKP 139
            :..|.|....:::|              |:..|.                :..:::|.:|...|.
  Fly    67 ATLTGPGLMPKQWH--------------PKDPKD----------------AQFLQYCKKCEGYKA 101

Human   140 DRCHHCSVCAMCVLKMDHHCPWVNNCIGFSNYKFFLQFLAYSVLYCLYIATTVFSYFIKYWRG-- 202
            .|.|||..|..||.||||||||:|:|:|::|:.:|..||.:|:|..|. .|.|..  ..:|||  
  Fly   102 PRSHHCRKCDRCVKKMDHHCPWINHCVGWANHAYFTYFLLFSILGSLQ-GTVVLC--CSFWRGIY 163

Human   203 ----------ELPSVRSKFHVLFLLFVACMFFVSLVI---------LF-----------GYHCWL 237
                      .|.||:    ...|..:.|:..:.|.|         ||           |...|:
  Fly   164 RYYYLTHGLAHLASVQ----FTLLSIIMCILGMGLAIGVVIGLSMLLFIQLKTIVNNQTGIEIWI 224

Human   238 VS-------RNKTTLEAFCTPVFTSGPEKNGFNLGFIKNIQQVFGDKKKFWLIPIGSSPGDGHSF 295
            |.       ||....:.|..|          ::||:..|::.||.|:.:        ..|||..:
  Fly   225 VEKAIYRRYRNADCDDEFLYP----------YDLGWRANLRLVFNDECQ--------KRGDGIEW 271

Human   296 PM 297
            |:
  Fly   272 PV 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZDHHC15NP_659406.1 zf-DHHC <126..308 CDD:327686 59/211 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 306..337
CG5196NP_650191.1 zf-DHHC 89..223 CDD:279823 43/140 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.