DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZDHHC15 and CG4483

DIOPT Version :9

Sequence 1:NP_659406.1 Gene:ZDHHC15 / 158866 HGNCID:20342 Length:337 Species:Homo sapiens
Sequence 2:NP_648294.1 Gene:CG4483 / 39057 FlyBaseID:FBgn0035970 Length:435 Species:Drosophila melanogaster


Alignment Length:323 Identity:79/323 - (24%)
Similarity:133/323 - (41%) Gaps:103/323 - (31%)


- Green bases have known domain annotations that are detailed below.


Human    17 RRVLSWVPV--LVIVLVVLWSYYAYVFELCLVTVL-------SPAEKVIYLILYHAIFV--FFT- 69
            ||.:.|.|:  |.:.|:|.|            ||:       :|...:..::.|..|::  |.| 
  Fly    10 RRFIHWGPITLLTLTLIVTW------------TVIHMNSMWWAPGSSLESVLNYALIWIQTFGTL 62

Human    70 WTYWKSIFTLPQQPNQKFHLSYTDKERYENEERPEVQKQMLVDMAKKLPVYTRTGSGAVRFCDRC 134
            :.:.:|:...|.....|:|              |::.|..:.                ::||.||
  Fly    63 YNFIRSLMVGPGFVPLKWH--------------PQLTKDKMF----------------LQFCTRC 97

Human   135 HLIKPDRCHHCSVCAMCVLKMDHHCPWVNNCIGFSNYKFFLQFLAY----SVLYCLYIATTVF-- 193
            :..|..|.|||..|..||:||||||||:|.|:|:||...|:.||.:    |:...:.|.:.|.  
  Fly    98 NGYKAPRSHHCRRCNRCVMKMDHHCPWINTCVGWSNQDSFVYFLLFFMSGSIHGGIIIVSAVIRG 162

Human   194 ---SYFIKYWRGELPSVRSKFHVLFLLFVACMFFVSLVI--------LFGYHCWLVSRNKTTLE- 246
               .:.|:|....:.:|    |:.....:||:|.:.:::        |.......:.:|:|.:| 
  Fly   163 IKKRWLIRYGLRHMATV----HLTQTNLLACVFSLGVIMGTVLASIKLLYMQMKSILKNQTEIEN 223

Human   247 ------AFCTPVFTSGPEKN------GFNLGFIKNIQQVFGDKKKFWLIPIGSSPGDGHSFPM 297
                  ||....:   |.|.      .:|||:..|:::||            .|.|||.|:|:
  Fly   224 WIVKKAAFRRNAY---PRKGIKPFVYPYNLGWKTNMREVF------------FSTGDGISWPV 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZDHHC15NP_659406.1 zf-DHHC <126..308 CDD:327686 58/202 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 306..337
CG4483NP_648294.1 zf-DHHC 88..224 CDD:279823 42/155 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.