DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZDHHC15 and CG1407

DIOPT Version :9

Sequence 1:NP_659406.1 Gene:ZDHHC15 / 158866 HGNCID:20342 Length:337 Species:Homo sapiens
Sequence 2:NP_001286264.1 Gene:CG1407 / 36043 FlyBaseID:FBgn0033474 Length:452 Species:Drosophila melanogaster


Alignment Length:298 Identity:139/298 - (46%)
Similarity:194/298 - (65%) Gaps:14/298 - (4%)


- Green bases have known domain annotations that are detailed below.


Human    16 CRRVLSWVPVLVIVLVVLWSYYAYVFELCLVTVLSPAEKVIYLILYHAIFVFFTWTYWKSIFTLP 80
            |..|..|:|||.|..|:.|||||||.|||:....:....:..|:.||.....|.|:||::|.|..
  Fly    16 CMAVFKWIPVLFITAVIAWSYYAYVVELCIRNSENRIGMIFMLLFYHLFLTLFMWSYWRTIMTSV 80

Human    81 QQPNQKFHLSYTDKERYENEERPEVQKQMLVDMAKKLPVYTRTGSGAVRFCDRCHLIKPDRCHHC 145
            .:...::.:...:..|....:.|:.||::|.:.|:.|||..||.:|:||||::|.:|||||.|||
  Fly    81 GRIPDQWRIPDEEVSRLFRADSPDTQKRILNNFARDLPVTNRTMNGSVRFCEKCKIIKPDRAHHC 145

Human   146 SVCAMCVLKMDHHCPWVNNCIGFSNYKFFLQFLAYSVLYCLYIATTVFSYFIKYWR--------- 201
            |||:.|||||||||||||||:.|.|||:|:.||.|:::||||:|.|....|:::|:         
  Fly   146 SVCSCCVLKMDHHCPWVNNCVNFYNYKYFVLFLGYALVYCLYVAFTSLHDFVEFWKVGAYDNNGY 210

Human   202 ---GEL-PSVRSKFHVLFLLFVACMFFVSLVILFGYHCWLVSRNKTTLEAFCTPVF-TSGPEKNG 261
               |:| .|...:||:|||.|:|.||.:|||.|||||.:||..|:||||:|..|:| ..||:|||
  Fly   211 SAQGQLNASGMGRFHILFLFFIAIMFAISLVSLFGYHIYLVLVNRTTLESFRAPIFRVGGPDKNG 275

Human   262 FNLGFIKNIQQVFGDKKKFWLIPIGSSPGDGHSFPMRS 299
            :|||...|..:||||..::|.:|:.||.|||:|:|..|
  Fly   276 YNLGRYANFCEVFGDDWQYWFLPVFSSRGDGYSYPTSS 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZDHHC15NP_659406.1 zf-DHHC <126..308 CDD:327686 101/188 (54%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 306..337
CG1407NP_001286264.1 zf-DHHC 129..259 CDD:279823 71/129 (55%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157929
Domainoid 1 1.000 174 1.000 Domainoid score I3682
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 329 1.000 Inparanoid score I2457
Isobase 1 0.950 - 0 Normalized mean entropy S2012
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 1 1.000 - - FOG0000300
OrthoInspector 1 1.000 - - otm41690
orthoMCL 1 0.900 - - OOG6_100499
Panther 1 1.100 - - O PTHR22883
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1716
SonicParanoid 1 1.000 - - X260
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.740

Return to query results.
Submit another query.