DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZDHHC15 and GABPI

DIOPT Version :9

Sequence 1:NP_659406.1 Gene:ZDHHC15 / 158866 HGNCID:20342 Length:337 Species:Homo sapiens
Sequence 2:NP_608741.1 Gene:GABPI / 33516 FlyBaseID:FBgn0031495 Length:420 Species:Drosophila melanogaster


Alignment Length:279 Identity:66/279 - (23%)
Similarity:106/279 - (37%) Gaps:68/279 - (24%)


- Green bases have known domain annotations that are detailed below.


Human     5 WKMALSGGLRCCRRV---LSWVPVLVIVLVVLWSYYAYVFELCLVTVLSPAEKVIYLILYHAIFV 66
            |.|.|:  .|...|.   |||:...|..:::::.:...:.|      |:|.|.  |.:::.:...
  Fly   135 WGMELA--KRTATRTNFFLSWLVFSVFYMIIIFEFQVPLLE------LAPEEN--YALMFFSCAA 189

Human    67 FFTWTYWKSIFTLPQQPNQKFHLSYTDK-----ERYENEERPEVQKQMLV--------DMAKKLP 118
            .:.....|::..| ...:.::..:..|:     |....||:.|.|..:.:        |....:.
  Fly   190 LYCLYSAKALSPL-NLVSAQYGTTPKDELPGIAEASSGEEQAEAQTTLQMESVLSLDDDEVGDMD 253

Human   119 VYTRTG--SGAVRFCDRCHLIKPDRCHHCSVCAMCVLKMDHHCPWVNNCIGFSNYKFFLQFLAYS 181
            ...|:|  .|....|:.|..:.|.|.:||.||..||.:.|||..|:|.|||..||.:::..||.|
  Fly   254 TAERSGLMHGQPNICEICRKVTPRRAYHCPVCGTCVKRRDHHSYWLNCCIGERNYVWYIVGLALS 318

Human   182 VLYCLYIATTVFSYFIKYWRGELPSVRSKFHVLFLLFVACMFFVSLVILFGYHCWLVSRNKTTLE 246
            .:..|..|...           |.|:...|.|:..|              ||        ...|.
  Fly   319 EIALLLGANLT-----------LTSICHPFMVVRPL--------------GY--------PVLLP 350

Human   247 AFCTPVFTSGPEKNGFNLG 265
            ..|:.||      .||:||
  Fly   351 DDCSEVF------EGFDLG 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZDHHC15NP_659406.1 zf-DHHC <126..308 CDD:327686 41/140 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 306..337
GABPINP_608741.1 zf-DHHC 262..399 CDD:279823 41/141 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.