DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AWAT2 and CG1946

DIOPT Version :9

Sequence 1:NP_001002254.1 Gene:AWAT2 / 158835 HGNCID:23251 Length:333 Species:Homo sapiens
Sequence 2:NP_610319.2 Gene:CG1946 / 35720 FlyBaseID:FBgn0033216 Length:349 Species:Drosophila melanogaster


Alignment Length:346 Identity:112/346 - (32%)
Similarity:180/346 - (52%) Gaps:44/346 - (12%)


- Green bases have known domain annotations that are detailed below.


Human     3 LPSKKDLKTALDVFAVFQWSFSALLITTTV-IAVNLYLVVFTPYWPVTVLILTWLAF-----DWK 61
            :|.::.|:|.:..|  |.::|..|.|::.: :|:.||      |..:.|..|..:.|     |:|
  Fly    10 VPLERRLQTLVTSF--FTYTFFTLPISSCLAVAILLY------YGEMFVRSLLLIYFVKIYLDYK 66

Human    62 TPQRGGRRFTCVR---------HWRLWKHYSDYFPLKLLKTHDICPSRNYILVCHPHGLFAHGWF 117
                  |.:..:.         :||    |.:|||::|:||.::.|:||||:...|||:...|..
  Fly    67 ------RNYGIMEGNGWLFYRSNWR----YRNYFPVELVKTAELPPNRNYIVASFPHGILGTGTC 121

Human   118 GHFATEASGFSKIFPGITPYILTLGAFFWMPFLREYVMSTGACSVSRSSIDFLLT------HKG- 175
            .:.:.:...:..::|.:.|.|.||...|..||||:.:...|..|||:.|:.:||:      ||. 
  Fly   122 INMSLDIDNWLSLYPHVRPKIATLDHHFKTPFLRDILRWWGMVSVSKESLSYLLSKSNDPMHKDN 186

Human   176 ----TGNMVIVVIGGLAECRYSLPGSSTLVLKNRSGFVRMALQHGVPLIPAYAFGETDLYDQHIF 236
                |.|.|.|::||..|...|.||...|.||:|.|||:||::.|..::|:.:|||.|::||...
  Fly   187 RDGFTSNAVAVLVGGAKEAMDSHPGQYILTLKDRKGFVKMAVRTGSSIVPSLSFGEVDIFDQVAN 251

Human   237 TPGGFVNRFQKWFQSMVHIYPCAFYGRGFTKNSWGLLPYSRPVTTIVGEPLPMPKIENPSQEIVA 301
            .|...:.|||...:....|.|....|||....::|:||:.|.:..:||.|:.:.:.|.|..|.|.
  Fly   252 PPDSSLRRFQNVVKKFTGISPLLPKGRGIFNYNYGILPHRRRIVQVVGSPIDVERCETPDPEYVD 316

Human   302 KYHTLYIDALRKLFDQHKTKF 322
            |.|...||||.::||::|.|:
  Fly   317 KIHGQVIDALARMFDEYKEKY 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AWAT2NP_001002254.1 LPLAT 38..332 CDD:388412 102/310 (33%)
CG1946NP_610319.2 LPLAT 80..349 CDD:302626 94/262 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146793
Domainoid 1 1.000 214 1.000 Domainoid score I2726
eggNOG 1 0.900 - - E1_KOG0831
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 235 1.000 Inparanoid score I3400
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53531
OrthoDB 1 1.010 - - D1347007at2759
OrthoFinder 1 1.000 - - FOG0000289
OrthoInspector 1 1.000 - - mtm8637
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12317
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X186
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.870

Return to query results.
Submit another query.