powered by:
Protein Alignment RHOXF1 and Drgx
DIOPT Version :9
Sequence 1: | XP_011529583.1 |
Gene: | RHOXF1 / 158800 |
HGNCID: | 29993 |
Length: | 212 |
Species: | Homo sapiens |
Sequence 2: | NP_001097075.2 |
Gene: | Drgx / 5740176 |
FlyBaseID: | FBgn0085369 |
Length: | 587 |
Species: | Drosophila melanogaster |
Alignment Length: | 120 |
Identity: | 41/120 - (34%) |
Similarity: | 56/120 - (46%) |
Gaps: | 38/120 - (31%) |
- Green bases have known domain annotations that are detailed below.
Human 111 PPPEEPAQAAMEGPQPENM------------------------------QPRTRRTKFTLLQVEE 145
||...|. ||.|..: :.|..||.|||.|:||
Fly 7 PPALHPC-----GPHPPRLPTLDYPFAATHPYTSYSYHPAIHDETFVRRKQRRNRTTFTLQQLEE 66
Human 146 LESVFRHTQYPDVPTRRELAENLGVTEDKVRVWFKNKRARCRRHQRELMLANELR 200
||:.|..|.||||.||.:||..:.:||.:|:|||:|:||:.|:.:| |.:|.|
Fly 67 LETAFAQTHYPDVFTREDLAMKINLTEARVQVWFQNRRAKWRKAER---LKDEQR 118
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
RHOXF1 | XP_011529583.1 |
homeodomain |
132..190 |
CDD:238039 |
31/57 (54%) |
Drgx | NP_001097075.2 |
Homeobox |
56..108 |
CDD:278475 |
29/51 (57%) |
OAR |
428..445 |
CDD:281777 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000011 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.