DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RHOXF1 and Drgx

DIOPT Version :10

Sequence 1:XP_011529583.1 Gene:RHOXF1 / 158800 HGNCID:29993 Length:212 Species:Homo sapiens
Sequence 2:NP_001097075.2 Gene:Drgx / 5740176 FlyBaseID:FBgn0085369 Length:587 Species:Drosophila melanogaster


Alignment Length:120 Identity:41/120 - (34%)
Similarity:56/120 - (46%) Gaps:38/120 - (31%)


- Green bases have known domain annotations that are detailed below.


Human   111 PPPEEPAQAAMEGPQPENM------------------------------QPRTRRTKFTLLQVEE 145
            ||...|.     ||.|..:                              :.|..||.|||.|:||
  Fly     7 PPALHPC-----GPHPPRLPTLDYPFAATHPYTSYSYHPAIHDETFVRRKQRRNRTTFTLQQLEE 66

Human   146 LESVFRHTQYPDVPTRRELAENLGVTEDKVRVWFKNKRARCRRHQRELMLANELR 200
            ||:.|..|.||||.||.:||..:.:||.:|:|||:|:||:.|:.:|   |.:|.|
  Fly    67 LETAFAQTHYPDVFTREDLAMKINLTEARVQVWFQNRRAKWRKAER---LKDEQR 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RHOXF1XP_011529583.1 homeodomain 132..190 CDD:238039 31/57 (54%)
DrgxNP_001097075.2 Homeodomain 53..109 CDD:459649 30/55 (55%)
OAR 428..446 CDD:461067
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.