DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP19A1 and Cyp4aa1

DIOPT Version :9

Sequence 1:NP_000094.2 Gene:CYP19A1 / 1588 HGNCID:2594 Length:503 Species:Homo sapiens
Sequence 2:NP_611067.2 Gene:Cyp4aa1 / 36752 FlyBaseID:FBgn0034053 Length:510 Species:Drosophila melanogaster


Alignment Length:474 Identity:113/474 - (23%)
Similarity:199/474 - (41%) Gaps:80/474 - (16%)


- Green bases have known domain annotations that are detailed below.


Human    36 LLVWNYEGTSSIPGPGYCMGIGPLISHGRFLWMGIGSACNYYNRVYGEFMRVWI---------SG 91
            ||.....|..|:|..|.||    |::....:....|.|.:    :||..:|:|:         ..
  Fly    43 LLSLRLTGPPSLPFLGNCM----LVTDKDLMRRCAGKAFD----LYGSLVRIWVLLFPFFAVLEP 99

Human    92 EETLIISKSSS-----MFHIMKHNHYSSRFGSKLGLQCIGMHEKGIIFNNNPELWKTTRPFFMKA 151
            |:..:|..|..     .|:.:.||.        ||        .|:|.::..: |...|.....|
  Fly   100 EDLQVILSSKKHTNKVFFYRLMHNF--------LG--------DGLITSSGSK-WSNHRRLIQPA 147

Human   152 LSGPGLVRMVTV---CAESLKTHLDRLEEVTNESGYVDVLTLLRRVMLDTSNTLFLRIPLDESAI 213
            .....|.:.:..   .::||..:|| .|.|..|   :::...:...:||..|...|.:|:.:...
  Fly   148 FHHNLLEKFIDTFVDASQSLYENLD-AEAVGTE---INIAKYVNNCVLDILNEAVLGVPIKKRGQ 208

Human   214 VVKIQGYFDAWQALLIKPDIFFKISWL----YKKYEKSVKD-------LKDAIEVLIAEKRRRI- 266
            .|.:.......|..::.|..|.: .||    ...:.|...|       |.|....:| ::||:| 
  Fly   209 DVAMMEDSPFRQGKIMMPARFTQ-PWLLLDGIYHWTKMANDELNQKKRLNDFTRKMI-QRRRQIQ 271

Human   267 -----STEEKLEEC-MDFATELILAEKRGDLTRENVNQCILEMLIAAPDTMSVSLFFMLFLIAKH 325
                 ::|.|   | :|...|  ::|...|.|.|::.......::|..|::..::.|.|||:.::
  Fly   272 NNNNGNSERK---CLLDHMIE--ISESNRDFTEEDIVNEACTFMLAGQDSVGAAVAFTLFLLTQN 331

Human   326 PNVEEAIIKEIQTVI--GERDIKIDDIQKLKVMENFIYESMRYQPVVDLVMRKALEDDVIDGYPV 388
            |..::..:.|:.|:.  ..|...:.|:.:::.||..|.|::|..|.|.|:.||..|:..:..:.:
  Fly   332 PECQDRCVLELATIFEDSNRAPTMTDLHEMRYMEMCIKEALRLYPSVPLIARKLGEEVRLAKHTL 396

Human   389 KKGTNIILNIGRMHRL-EFFPKPNEFTLENFA-----KNVPYRYFQPFGFGPRGCAGKYIAMVMM 447
            ..|:|:.:.....||| ..:|.|.:|..|.|:     ...||. |.||..|||.|.|...|::.:
  Fly   397 PAGSNVFICPYATHRLAHIYPDPEKFQPERFSPENSENRHPYA-FLPFSAGPRYCIGNRFAIMEI 460

Human   448 KAILVTLLRRFHVKTLQGQ 466
            |.|:..|||.:.:..:.|:
  Fly   461 KTIVSRLLRSYQLLPVTGK 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP19A1NP_000094.2 CYP19A1 72..485 CDD:410709 103/438 (24%)
Cyp4aa1NP_611067.2 p450 50..475 CDD:278495 110/461 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154694
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24291
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.