DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP19A1 and Cyp4p3

DIOPT Version :9

Sequence 1:NP_000094.2 Gene:CYP19A1 / 1588 HGNCID:2594 Length:503 Species:Homo sapiens
Sequence 2:NP_610473.1 Gene:Cyp4p3 / 35948 FlyBaseID:FBgn0033397 Length:515 Species:Drosophila melanogaster


Alignment Length:357 Identity:96/357 - (26%)
Similarity:167/357 - (46%) Gaps:58/357 - (16%)


- Green bases have known domain annotations that are detailed below.


Human   166 ESLKTHLDRLEEVT-NESGYVDVLTLLRRVMLDTSNTLFLRIPLDESAIVVKIQGYFDAWQALLI 229
            ||||.    ||:.. |:...:.:..::.|..|::.....:.:.|||.|  .|...|.:.::.:  
  Fly   163 ESLKF----LEQFKGNDEAIISLNEVIPRFTLNSICETAMGVKLDEMA--EKGDRYRENFRQI-- 219

Human   230 KPDIFFK-----ISW---LYKKYEKSVKDLKDAIEV-------LIAEKRRRISTE---------- 269
             .:.|.:     :.|   |:|.:.:  ||...|::|       :||::|.:::.|          
  Fly   220 -EECFIRRMSNPLLWSDTLFKMFAE--KDYASALDVVHGFSSEIIAKRRDQLNDEIDSRGNTQTA 281

Human   270 --EKLEECMDFA--TELILAEKRGDLTRENVNQCILEMLIAAPDTMSVSLFFMLFLIAKHPNVEE 330
              |.......||  ..||||||.|.:....:.:.:..::....||.|:.|.|.|..::.:|..:|
  Fly   282 EDELFTSKKRFAMLDTLILAEKDGLIDHIGICEEVDTLMFEGYDTTSIGLMFGLMNMSLYPEEQE 346

Human   331 AIIKEIQTVIGE--RDIKIDDIQKLKVMENFIYESMRYQPVVDLVMRKAL-EDDVIDGYPVKKGT 392
            ...:|||..|.:  ..:.|..:.|||.:|.||.|:||..|.|..:.|:.. |.::.:|..:.||:
  Fly   347 KCYQEIQANIDDELNILNIGQLNKLKNLEYFIKETMRLFPSVPAMGRETTRETELSNGLILPKGS 411

Human   393 NIILNIGRMHR-LEFFPKPNEFTLENF-AKNVPYRY---FQPFGFGPRGCAGKYIAMVMMKAILV 452
            .|.:::..:|| .|::..|.||..|.| .:|...|:   :.||..|.|.|.|:..||..||.::|
  Fly   412 QIFVHVFDIHRNPEYWDSPEEFRPERFLPENSQNRHTYAYIPFSAGQRNCIGQKFAMQEMKTLMV 476

Human   453 TLLRRFHV------KTL---QGQCVESIQKIH 475
            .||::|.:      ||:   .|..:.:..:||
  Fly   477 ALLKQFQILPEIDPKTIVFQTGLTLRTKNQIH 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP19A1NP_000094.2 CYP19A1 72..485 CDD:410709 96/357 (27%)
Cyp4p3NP_610473.1 p450 54..505 CDD:278495 94/352 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154886
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24291
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.