DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP19A1 and Cyp4p2

DIOPT Version :9

Sequence 1:NP_000094.2 Gene:CYP19A1 / 1588 HGNCID:2594 Length:503 Species:Homo sapiens
Sequence 2:NP_610472.1 Gene:Cyp4p2 / 35946 FlyBaseID:FBgn0033395 Length:520 Species:Drosophila melanogaster


Alignment Length:438 Identity:113/438 - (25%)
Similarity:193/438 - (44%) Gaps:99/438 - (22%)


- Green bases have known domain annotations that are detailed below.


Human    90 SGEETLIISKSSSMFHIM-KHNHYSSRFGSKLGLQCIGMHEKGIIFN-NNPEL-----------W 141
            ||:..|..|...|.|::: .||..:.       |....:..||:|:| .:|.|           |
  Fly    82 SGDSYLQYSMGFSNFNVIDAHNAANI-------LNHPNLITKGVIYNFLHPFLRTGVLTATEKKW 139

Human   142 KT-----TRPFFMKALSGPGLVRMVTVCAESLKTHLDRLEEVTNESGYVDVLTLLR-RVMLDTSN 200
            .|     ||.|.:..|:   ..:.:.: |||||.       |:...|..:|:..|: |:...|.|
  Fly   140 HTRRSMLTRTFHLDILN---QFQEIFI-AESLKF-------VSQFQGQNEVVVSLKDRISRFTLN 193

Human   201 TL---FLRIPLDESAIVVKIQGYFDAWQA-----------LLIKPDIFFKISW---LYK-----K 243
            ::   .:.|.|||.|    .:|  |.::|           .::.|     :.|   :|.     |
  Fly   194 SICETAMGIKLDEMA----EKG--DRYRANFHIIDEGLTRRIVNP-----LYWDDCVYNMFTGHK 247

Human   244 YEKSVKDLKDAIEVLIAEKRRRISTEEKLEE-----------CM----DFA--TELILAEKRGDL 291
            |..::|.:.:....:||  :||:..||:||.           |:    .||  ..||.|||.|.:
  Fly   248 YNAALKVVHEFSREIIA--KRRVLLEEELENRRATQTADDDICVIRKKRFAMLDTLICAEKDGLI 310

Human   292 TRENVNQCILEMLIAAPDTMSVSLFFMLFLIAKHPNVEEAIIKEIQTVIGE--RDIKIDDIQKLK 354
            ....:::.:..::....||.|:.|.|.|..::.:...:|...:|||..|.:  .::.:..:.||.
  Fly   311 DDIGISEEVDTLMAEGYDTTSIGLVFGLMNMSLYAAEQELCYQEIQEHILDDLSNLNLSQLSKLN 375

Human   355 VMENFIYESMRYQPVVDLVMRKAL-EDDVIDGYPVKKGTNIILNIGRMHR-LEFFPKPNEFTLEN 417
            .:..||.|:||..|.:.::.|:.| |.::.:|..:.|.:.|.:::..:|| .:::..|.||..|.
  Fly   376 YLGYFIKETMRLYPSIPIMGRQTLQETELENGLILPKRSQINIHVFDIHRNPKYWESPEEFRPER 440

Human   418 F-----AKNVPYRYFQPFGFGPRGCAGKYIAMVMMKAILVTLLRRFHV 460
            |     .|..||.|. ||..|.|.|.|:..||..||.::|.:|:.|.:
  Fly   441 FLPQNCLKRHPYAYI-PFSAGQRNCIGQKYAMQEMKTLMVVILKHFKI 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP19A1NP_000094.2 CYP19A1 72..485 CDD:410709 113/438 (26%)
Cyp4p2NP_610472.1 p450 63..514 CDD:299894 113/438 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154888
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24291
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.