DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP19A1 and Cyp4ac3

DIOPT Version :9

Sequence 1:NP_000094.2 Gene:CYP19A1 / 1588 HGNCID:2594 Length:503 Species:Homo sapiens
Sequence 2:NP_608918.1 Gene:Cyp4ac3 / 33756 FlyBaseID:FBgn0031695 Length:509 Species:Drosophila melanogaster


Alignment Length:523 Identity:119/523 - (22%)
Similarity:210/523 - (40%) Gaps:105/523 - (20%)


- Green bases have known domain annotations that are detailed below.


Human     1 MVLEMLNPIHYNITSIVPEAMPAATMP----VLLLTG-------LFLL------VWNY--EGTSS 46
            ::|..||..:: |.|:......|...|    |.::.|       |.||      :::|  |.|:.
  Fly    17 LLLRQLNKTYF-ILSLCKRVRTADGSPLESKVFVVPGKTRFGNNLDLLNLTPANIFSYIRESTAK 80

Human    47 IPGPGYCMGIGPLISHGRFLWMGIGSACNY-----YNRVYGEFMRVWISGEE----TLIISKSSS 102
            ..|..|             :|       |:     ||.|..|      ..||    |.|.:|:  
  Fly    81 ANGQNY-------------IW-------NFLFAPEYNIVRAE------DAEEIFQSTKITTKN-- 117

Human   103 MFHIMKHNHYSSRFGSKLGLQCIGMHEKGIIFNNNPELWKTTRPFFMKALSGPGLVRMVTVCAES 167
                |.:.......|..|   .|.:.:|          |.|.|.....|.....|...:::..|.
  Fly   118 ----MSYELIRPFLGDGL---LISIDQK----------WHTRRKTLTPAFHFNILQSFLSIFKEE 165

Human   168 LKTHLDRLEEVTNESGYVDVLTLLRRVMLDTSNTLFLRIPLDE----SAIVVKIQGYFDAWQALL 228
            .|..:..|::  |....:::..::.:..|:......|.:.||:    :.....|..:...:...:
  Fly   166 SKKFIKILDK--NVGFELELNQIIPQFTLNNICETALGVKLDDMSEGNEYRKAIHDFEIVFNQRM 228

Human   229 IKPDIFFKISWL------YKKYEKSVKDLKDAIEVLIAEKRRRISTEEKLEECMDFATE------ 281
            ..|.:||  :|.      ||||.:.::.:......:|..||::.. :::|.:..:|..:      
  Fly   229 CNPLMFF--NWYFFLFGDYKKYSRILRTIHGFSSGIIQRKRQQFK-QKQLGQVDEFGKKQRYAML 290

Human   282 --LILAEKRGDLTRENVNQCILEMLIAAPDTMSVSLFFMLFLIAKHPNVEEAIIKEIQTVIGERD 344
              |:.||..|.:..:.:...:...:....||.|.||.|.|.|:|.|.:|:|...:|:|.:..:.|
  Fly   291 DTLLAAEAEGKIDHQGICDEVNTFMFGGYDTTSTSLIFTLLLLALHADVQERCYEELQDLPEDID 355

Human   345 -IKIDDIQKLKVMENFIYESMRYQPVVDLVMRKALEDDVIDGYPVKKGTNIILNI-GRMHRLEFF 407
             :.:....:|..:|..|.||:|..|...::.|..:|:.|::|..:.|...|.::| ..|.....|
  Fly   356 EVSMFQFNELIHLECVIKESLRLFPSAPIIGRTCIEESVMNGLVLPKNAQISIHIYDIMRDARHF 420

Human   408 PKPNEFTLENF-AKNVPYRY---FQPFGFGPRGCAGKYIAMVMMKAILVTLLRRFHVKTLQGQCV 468
            ||||:|..|.| .:|...|:   |.||..|||.|.|:...::.:|.:|..::|.|  |.|....:
  Fly   421 PKPNQFLPERFLPENSVNRHPFAFVPFSAGPRNCIGQKFGVLEIKVLLAAVIRNF--KLLPATQL 483

Human   469 ESI 471
            |.:
  Fly   484 EDL 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP19A1NP_000094.2 CYP19A1 72..485 CDD:410709 101/433 (23%)
Cyp4ac3NP_608918.1 p450 51..504 CDD:278495 111/488 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154885
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24291
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.