DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP19A1 and Cyp4s3

DIOPT Version :9

Sequence 1:NP_000094.2 Gene:CYP19A1 / 1588 HGNCID:2594 Length:503 Species:Homo sapiens
Sequence 2:NP_573003.2 Gene:Cyp4s3 / 32444 FlyBaseID:FBgn0030615 Length:495 Species:Drosophila melanogaster


Alignment Length:497 Identity:114/497 - (22%)
Similarity:197/497 - (39%) Gaps:137/497 - (27%)


- Green bases have known domain annotations that are detailed below.


Human    35 FLLVWNYEGTSSIPGPGYCMGIGPLISHGRFLWMGIGSACNYYNRV---YGEFMRVWISGEETLI 96
            ||.:..:..|  :|||    .||.||::     :..|...|:...:   :|...|:|...:..::
  Fly    25 FLRLQRFAKT--LPGP----TIGELIAN-----VKKGEILNWLKELREKHGPVFRIWFGKDLMVM 78

Human    97 ISKSSSMFHIMKHNHYSSRFGS-KLGLQCIGMHEKGIIFNNNPELWKTTRPFFMKALSGPG---- 156
            .:....:..::.:|...::..: :|....:|   ||:: .|..|.|...|    |.|: ||    
  Fly    79 FTDPEDIKQLLGNNQLLTKSRNYELLEPWLG---KGLL-TNGGESWHRRR----KLLT-PGFHFR 134

Human   157 ---------------LVRMV---------------------TVC--AESLKTHLDRLEEVTNESG 183
                           |||.:                     .:|  |..:|.|    .::.::|.
  Fly   135 ILSEFKEPMEENCRILVRRLRTKANGESFDIYPYITLFALDAICETAMGIKKH----AQLQSDSE 195

Human   184 YVDVLTLLRRVMLDTSNTLFLRIPLDESAIVVKIQGYFDAWQALLIKPDIFFKISWLYKKYEKSV 248
            ||..:..:.|||...|                     |..||.|    ::||       |:.|..
  Fly   196 YVQAVQSICRVMHKQS---------------------FSFWQRL----NVFF-------KHTKPG 228

Human   249 KDLKDAIEVLIAEKRR--RISTEEKLEECMDFATE-----------------LILAEKRG--DLT 292
            |:.:.|::||..|..|  |:..|:.::|..::..|                 |:|.:..|  :|:
  Fly   229 KEREAALKVLHDETNRVIRLRREQLIQERNEWKPEAEQDDVGAKRRLAFLDMLLLTQMEGGAELS 293

Human   293 RENVNQCILEMLIAAPDTMSVSLFFMLFLIAKHPNVEEAIIKEIQTVIGERDIKIDDIQKLKVME 357
            ..::.:.:...:....||.|.::.|.|.|::|:|:|::...:|...:.|.      :.:.:..:|
  Fly   294 DTDIREEVDTFMFEGHDTTSSAIAFALSLLSKNPDVQQRAFEEASELEGR------EKESMPYLE 352

Human   358 NFIYESMRYQPVVDLVMRKALEDDVIDGYPVKKGTNIILNIGRMHR-LEFFPKPNEFTLENFAKN 421
            ..|.|::|..|.|....||.|||..:....|.||.:|...|..:|| .:.||.|..|..:.|..|
  Fly   353 AVIKETLRIYPSVPFFSRKVLEDLEVGKLTVPKGASISCLIYMLHRDPKNFPDPERFDPDRFLVN 417

Human   422 VPYRYFQPFGF-----GPRGCAGKYIAMVMMKAILVTLLRRF 458
              .:...||.|     |||.|.|:..||:.:|..|..|||.:
  Fly   418 --EKQMHPFAFAAFSAGPRNCIGQKFAMLELKTSLAMLLRSY 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP19A1NP_000094.2 CYP19A1 72..485 CDD:410709 103/460 (22%)
Cyp4s3NP_573003.2 p450 35..469 CDD:278495 111/485 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154693
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24291
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.