DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP19A1 and Cyp318a1

DIOPT Version :9

Sequence 1:NP_000094.2 Gene:CYP19A1 / 1588 HGNCID:2594 Length:503 Species:Homo sapiens
Sequence 2:NP_727590.1 Gene:Cyp318a1 / 32172 FlyBaseID:FBgn0030369 Length:536 Species:Drosophila melanogaster


Alignment Length:425 Identity:84/425 - (19%)
Similarity:175/425 - (41%) Gaps:70/425 - (16%)


- Green bases have known domain annotations that are detailed below.


Human   127 MHEKGIIFNNNPELWKTTRPFFMKALSGPGLVRMVTVCAESLKTHLDRLEEVTNESGYVDVLT-- 189
            :|.:|       :.||..|.....|.|...:.....|........:::.:..||..|.....|  
  Fly   116 LHARG-------QKWKLRRKQLNPAFSHNIVASFFDVFNSVGNQMVEQFQTQTNLHGQAVKFTAA 173

Human   190 --LLRRVMLDTSNTLFLRIP-----LDESAIVVKIQGYFDAWQALLIKPDIFFKI------SWLY 241
              ||.|.:|:.|....:..|     ||::.|....:...:.....::||.:..::      ..||
  Fly   174 EDLLSRAVLEVSCLTIMGTPTNFTQLDDAHIAHSYKRLLEISAVRVVKPWLQIRLLHRLLAPELY 238

Human   242 KKYEKSVKDLKDAIEVLIAEKRRR------ISTEEKLEECMD------FATELILAEKRGDLTRE 294
            ::.:|..|.|:|.:..::..|.|.      :..|:..|:..:      |..::......|::|.|
  Fly   239 EESKKCAKLLEDFVGGIVRTKHRNWRLRDAVGGEKSGEDASNGWQRRIFIEQIFQLAANGEMTLE 303

Human   295 NVNQCILEMLIAAPDTMSVSLFFMLFLIAKHP-NVEEAIIKEIQTVIGE-RDIKIDDIQKLKVME 357
            .:......|::.:.:|:|.|:...|..:|.:. :.:..::.||:.::.: ..:.::.:|:|:.::
  Fly   304 EIMDEAQSMVLVSFETVSNSIMLALLCLATNKGDCQRRLLAEIRALVPDVGQVGLEQLQQLRYLD 368

Human   358 NFIYESMRYQPVVDLVMRKALEDDVIDGYP----VKKGTNIILNIGRMHRLEFFPKPN--EFTLE 416
            .|:.||:|....|.:.:|....|..:.|..    |.:.:.::|:...|.|.|.:...|  :|..:
  Fly   369 AFVSESLRLLATVPMNLRHVSRDFRLAGRQHETIVPQNSIVVLDTFNMQRDERWWGANARQFDPQ 433

Human   417 NF----------------------AKNVPYRY-FQPFGFGPRGCAGKYIAMVMMKAILVTLLRRF 458
            .|                      .::..:.| |.||..|.|.|.|:...:.:||..||.|:..|
  Fly   434 RFLDQEEEQLSKGHNDSGSGEKRRQRDRRHSYSFLPFSNGLRSCIGRRYGLFIMKVFLVKLITNF 498

Human   459 HVKTLQGQCVESIQKIHDLSLHPDETKNMLEMIFT 493
            ..::  ...:|.:|.:.::||   :.||..:::.|
  Fly   499 DFQS--DFELEKLQFVENISL---KFKNADDILLT 528

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP19A1NP_000094.2 CYP19A1 72..485 CDD:410709 81/415 (20%)
Cyp318a1NP_727590.1 p450 42..503 CDD:299894 77/395 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.