DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP19A1 and Cyp4g1

DIOPT Version :9

Sequence 1:NP_000094.2 Gene:CYP19A1 / 1588 HGNCID:2594 Length:503 Species:Homo sapiens
Sequence 2:NP_525031.1 Gene:Cyp4g1 / 30986 FlyBaseID:FBgn0010019 Length:556 Species:Drosophila melanogaster


Alignment Length:578 Identity:133/578 - (23%)
Similarity:228/578 - (39%) Gaps:134/578 - (23%)


- Green bases have known domain annotations that are detailed below.


Human     1 MVLEMLNPIHYNITSIVPEAMPAATMPVLLLTGLFLL-VW-----NYEGTSSIPGPGYCMGIGPL 59
            :|.|.|.....:.::.|....|..|..|..|..:.|. .|     .|...::||.|.....:|..
  Fly     5 VVQETLQQAASSSSTTVLGFSPMLTTLVGTLVAMALYEYWRRNSREYRMVANIPSPPELPILGQA 69

Human    60 -----ISHGRFLWMGIGSACNYYNRVYGEFMRVWIS----------GEETLIISKSSSMFHIMKH 109
                 :|:...|.:|:|    |.|: |||.|:.|:.          .:..||:|....:....::
  Fly    70 HVAAGLSNAEILAVGLG----YLNK-YGETMKAWLGNVLLVFLTNPSDIELILSGHQHLTKAEEY 129

Human   110 NHYSSRFGSKLGLQCIGMHEKGIIFNNNPELWKTTR----PFFMKAL-----------SGPGLVR 159
            .::...||.            |::.:|... |:..|    |.|.:::           |...:.|
  Fly   130 RYFKPWFGD------------GLLISNGHH-WRHHRKMIAPTFHQSILKSFVPTFVDHSKAVVAR 181

Human   160 MVTVCAESLKTHLDRLEEVTNESGYVDVL--TLLRRVMLDTSNTLF--LRIPLDESAIVVKIQGY 220
            |.....:|...| |.:.:.|     ||:|  |.:....|...|..|  .:..:|...|:.|.|  
  Fly   182 MGLEAGKSFDVH-DYMSQTT-----VDILLSTAMGVKKLPEGNKSFEYAQAVVDMCDIIHKRQ-- 238

Human   221 FDAWQALLIKPDIFFKISWLYKKYE-----------KSVKDLKDAIEVLIAEKRRRI-------- 266
                ..||.:.|..:|.:.|.:|.:           |.|||.|:..:    |:.|.|        
  Fly   239 ----VKLLYRLDSIYKFTKLREKGDRMMNIILGMTSKVVKDRKENFQ----EESRAIVEEISTPV 295

Human   267 -----STEEKLEECMDFATELILAEKRG----------------DLTRENVNQCILEMLIAAPDT 310
                 |.:|.|.:.:|...|..:..||.                :...:::...:..::....||
  Fly   296 ASTPASKKEGLRDDLDDIDENDVGAKRRLALLDAMVEMAKNPDIEWNEKDIMDEVNTIMFEGHDT 360

Human   311 MSVSLFFMLFLIAKHPNVEEAIIKEIQTVIGE---RDIKIDDIQKLKVMENFIYESMRYQPVVDL 372
            .|....|.|.::..|.:::..:..|.:.:.|:   ||....|..::|.:|..|.|::|..|.|.|
  Fly   361 TSAGSSFALCMMGIHKDIQAKVFAEQKAIFGDNMLRDCTFADTMEMKYLERVILETLRLYPPVPL 425

Human   373 VMRKALEDD--VIDG-YPVKKGTNIILNIGRMHRL-EFFPKPNEFTLENF----AKNVPYRYFQP 429
            :.|: |:.|  :..| |.|.|||.:|:....:||. :.:|.|.:|..:||    ..|..|..|.|
  Fly   426 IARR-LDYDLKLASGPYTVPKGTTVIVLQYCVHRRPDIYPNPTKFDPDNFLPERMANRHYYSFIP 489

Human   430 FGFGPRGCAGKYIAMVMMKAILVTLLRRFHVKT--------LQGQCVESIQKIHDLSL 479
            |..|||.|.|:..||:.:|.:|.|::|.:.|.:        ||...:..::...::||
  Fly   490 FSAGPRSCVGRKYAMLKLKVLLSTIVRNYIVHSTDTEADFKLQADIILKLENGFNVSL 547

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP19A1NP_000094.2 CYP19A1 72..485 CDD:410709 114/496 (23%)
Cyp4g1NP_525031.1 p450 58..518 CDD:278495 116/494 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24291
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.