DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP11B2 and Cyp12e1

DIOPT Version :9

Sequence 1:NP_000489.3 Gene:CYP11B2 / 1585 HGNCID:2592 Length:503 Species:Homo sapiens
Sequence 2:NP_650003.4 Gene:Cyp12e1 / 41272 FlyBaseID:FBgn0037817 Length:522 Species:Drosophila melanogaster


Alignment Length:518 Identity:129/518 - (24%)
Similarity:231/518 - (44%) Gaps:68/518 - (13%)


- Green bases have known domain annotations that are detailed below.


Human    19 QRARALGTRAARAPRTVLPFEAMPQHPGNRWLRLLQIWREQGYEHLHLEMHQTF----QELGPIF 79
            |:|.|:....|:      |:..:   ||...|:|::.:...|. :.:|.:|:.|    ::.|.||
  Fly    25 QKATAVNLEEAK------PYADI---PGPSKLQLIRAFLPGGL-YKNLPVHEMFLDMNRQYGSIF 79

Human    80 RY-NLGGPRMVCVMLPEDVEKLQQVDSLHPCRMILEPWVAY-RQHR-----GHKCGVFLLNGPEW 137
            |. ::.|..:|..|.|:|.|.:.:.:..:|.|...|....: |.||     |:. |:...|||.|
  Fly    80 RMPSVAGTDLVLTMNPQDYEVIFRNEGQYPYRRSFEVMDYFKRVHRREVFDGYD-GLTSGNGPAW 143

Human   138 RFNRLRLNPDVLSPKAVQRFLPMVDAVARDFSQ---ALKKKVLQNARGSLTLDVQPSIFHYTIEA 199
            ...|..:||.:|.|:..:.::..:..|:.:|.:   .::..|.|.......:|::    |..||:
  Fly   144 GKMRTAVNPILLQPRNAKLYMTNLVQVSDEFLERIRIIRDPVTQEMPDDFAVDIR----HLVIES 204

Human   200 SNLALFGERLGLVGHSPSSASL-NFLHALEVMFKSTVQLMFMPRSLSRWISPKVWKEHFEAWD-- 261
            .........|||:|...::..: ..:.||:.:.:...||..|| :..:::....:|:...:.|  
  Fly   205 ICSVALNTHLGLLGEQRNNKDIQKLVLALQDVVELGFQLDIMP-AFWKYLPMPNFKKLMRSLDTI 268

Human   262 ---CIFQYGDNCIQKIYQELAFNRPQHYTGIVAELLLK-AELSLEAIKANSMELTAGSVDTTAFP 322
               |.|..| |.:::| :|.|.....:..|:...||.| |....:.....:|:|.....|.|...
  Fly   269 TDFCYFHIG-NALKRI-EEDAKAGTLNEIGLETSLLEKLARFDRQTAVIIAMDLLFAGADPTLVT 331

Human   323 LLMTLFELARNPDVQQILRQESLAAAASISEHPQKATT-----ELPLLRAALKETLRLYPVGLFL 382
            |...||.|:::||.|..|.:|    ...|..:...:.|     .||.|||.:||.:|:||:|...
  Fly   332 LGGILFSLSKSPDKQARLLEE----IRGILPNKDSSLTIENMRNLPYLRACIKEGIRMYPIGPGT 392

Human   383 ERVVSSDLVLQNYHIPAGTLVQVFL-YSLGRNAALFPRPERYNPQRWLD-------IRGSGRNFH 439
            .|.:..|:||..|.:.|||.|.:.. |.:.......|:...:.|:|||.       :..:...|.
  Fly   393 LRRMPHDVVLSGYRVVAGTDVGIAANYQMANMEQFVPKVREFIPERWLRDESNSHLVGETATPFM 457

Human   440 HVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHFLV------------ETLTQEDIKMVYSFILR 490
            ::|||||.|.|.|:|:.:..:.:.:..::::|.:            :...|.:|...:.||.|
  Fly   458 YLPFGFGPRSCAGKRIVDMMLEIAISRLVRNFKIGFDYPIENAFKAQFFVQPNIPFKFKFIER 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP11B2NP_000489.3 p450 42..454 CDD:365848 117/445 (26%)
Cyp12e1NP_650003.4 p450 63..517 CDD:299894 115/465 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0159
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D185685at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.