DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP11B2 and Cyp49a1

DIOPT Version :9

Sequence 1:NP_000489.3 Gene:CYP11B2 / 1585 HGNCID:2592 Length:503 Species:Homo sapiens
Sequence 2:NP_001246256.1 Gene:Cyp49a1 / 36105 FlyBaseID:FBgn0033524 Length:589 Species:Drosophila melanogaster


Alignment Length:523 Identity:133/523 - (25%)
Similarity:240/523 - (45%) Gaps:60/523 - (11%)


- Green bases have known domain annotations that are detailed below.


Human    21 ARALGTRAARAP-RTVLPFEAMP-QHP----GNRW--LRLLQIWREQGYEHLHLEMHQTFQELGP 77
            |.:|......:| ..|.|:..:| .:|    ||.|  ..|:..::....:.:..|:|..:.::..
  Fly    82 ASSLPAETTSSPAAAVRPYSEVPGPYPLPLIGNSWRFAPLIGTYKISDLDKVMNELHVNYGKMAK 146

Human    78 IFRYNLGGPRMVCVMLPEDVEKLQQVDSLHPCRMILEPWVAY-----RQHRGHKCGVFLLNGPEW 137
            :... :|.|.::.|...:::..:.:.:...|.|..:.....|     |...|...|:..::||:|
  Fly   147 VGGL-IGHPDLLFVFDGDEIRNIFKKEEAMPHRPSMPSLRHYKGDLRRDFFGDVAGLIGVHGPKW 210

Human   138 RFNRLRLNPDVLSPKAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNL 202
            ...|..:...:|.|:..::::|.::.:|.:|...:  :::::.:..|..:....::.:.:|:...
  Fly   211 EAFRQEVQHILLQPQTAKKYIPPLNDIASEFMGRI--ELMRDEKDELPANFLHELYKWALESVGR 273

Human   203 ALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQL-MFMPRSLSRWISPKVWKEHFEAWDCIFQY 266
            .....|||.:....|..:...:.|:...|.:..:| :.||  |.|....|.::...:|.|   |:
  Fly   274 VSLDTRLGCLSPEGSEEAQQIIEAINTFFWAVPELELRMP--LWRIYPTKAYRSFVKALD---QF 333

Human   267 GDNCIQKIYQEL---------AFNRPQHYTGIVAELLLK-AELSLEAIKANSMELTAGSVDTTAF 321
            ...|::.|.:.:         ..::.:....||..::.| ....|.||.|  ::|....||||:.
  Fly   334 TAICMKNIGKTMDKADADEARGLSKSEADISIVERIVRKTGNRKLAAILA--LDLFLVGVDTTSV 396

Human   322 PLLMTLFELARNPDVQQILRQESLAAAASISEH-----PQKATTELPLLRAALKETLRLYPVGLF 381
            ....|:::||:|||.|:.|..|    ...:..|     .|....::|.|||.:|||||:.||.:.
  Fly   397 AASSTIYQLAKNPDKQKKLFDE----LQKVFPHREADINQNVLEQMPYLRACVKETLRMRPVVIA 457

Human   382 LERVVSSDLVLQNYHIPAGTLVQVFLYSLGRN-AALFPRPERYNPQRWL----DIRG---SGRNF 438
            ..|.:.||.|:..||:|.||.| :|.:.:..| .|.||.|:|:.|:|||    |..|   :.:..
  Fly   458 NGRSLQSDAVINGYHVPKGTHV-IFPHLVVSNDPAYFPEPKRFLPERWLKQSTDAAGCPHANQKI 521

Human   439 H---HVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHFLVETLTQEDIKMVYSFILRPGTSPL---L 497
            |   .:|||||.|.|:|||.||.|:..||..:.:.:.|...:.|.:..|.|..:  ..|||   |
  Fly   522 HPFVSLPFGFGRRMCVGRRFAEIELHTLLAKIFRKYKVSYNSGEFVYRVNSTYI--PQSPLNFKL 584

Human   498 TFR 500
            |.|
  Fly   585 TLR 587

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP11B2NP_000489.3 p450 42..454 CDD:365848 111/450 (25%)
Cyp49a1NP_001246256.1 p450 104..565 CDD:299894 119/475 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0159
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D185685at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.