DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP11B2 and Cyp12d1-p

DIOPT Version :9

Sequence 1:NP_000489.3 Gene:CYP11B2 / 1585 HGNCID:2592 Length:503 Species:Homo sapiens
Sequence 2:NP_001286304.1 Gene:Cyp12d1-p / 246648 FlyBaseID:FBgn0050489 Length:521 Species:Drosophila melanogaster


Alignment Length:444 Identity:113/444 - (25%)
Similarity:194/444 - (43%) Gaps:71/444 - (15%)


- Green bases have known domain annotations that are detailed below.


Human    95 EDVEKLQQVDSLHPCRMILEPWVAYRQH-----RGHKCGVFLLNGPEWRFNRLRLNPDVLSPKAV 154
            :|:|.:.:.:.:.|.|..|:..|.:|:|     .|...|:.......|...|..:||..:.|:.:
  Fly   101 KDIEMVFRNEGIWPRRDGLDSIVYFREHVRPDVYGEVQGLVASQNEAWGKLRSAINPIFMQPRGL 165

Human   155 QRFLPMVDAVARDFSQALKKKVLQNARGSLTLDV----QPSIFHYTIEASNLALFGERLGLV-GH 214
            :.:...:..:..:|.:.:|:     .|...||:|    ...|.....|:..|..|..::||: .:
  Fly   166 RMYYEPLSNINNEFIERIKE-----IRDPKTLEVPEDFTDEISRLVFESLGLVAFDRQMGLIRKN 225

Human   215 SPSSASLNFLHALEVMFKSTVQLMFMPRSLSRW--------------------ISPKVWKEHFEA 259
            ..:|.:|........:|:.|.:|...|   |.|                    ::.|:.||:.:|
  Fly   226 RDNSDALTLFQTSRDIFRLTFKLDIQP---SMWKIISTPTYRKMKRTLNDSLNVAQKMLKENQDA 287

Human   260 WDCIFQYGDNCIQKIYQELAFNRPQHYTGIVAELLLKAELSLEAIKANSMELTAGSVDTTAFPLL 324
            .:...|.|    :||.......|.......||.::             |:::....||.||..|.
  Fly   288 LEKRRQAG----EKINSNSMLERLMEIDPKVAVIM-------------SLDILFAGVDATATLLS 335

Human   325 MTLFELARNPDVQQILRQESLAAAAS----ISEHPQKATTELPLLRAALKETLRLYPVGLFLERV 385
            ..|..|:::||.|..||:|.|:...:    ::|...|   ::|.|||.:|||||.||.||...|.
  Fly   336 AVLLCLSKHPDKQAKLREELLSIMPTKDSLLNEENMK---DMPYLRAVIKETLRYYPNGLGTMRT 397

Human   386 VSSDLVLQNYHIPAGTLVQVFLYSLGRNAALFPRPERYNPQRWLDIRGSGRN-----FHHVPFGF 445
            ..:|::|..|.:|.||.|.:....|.:.|..:|||:.:.|:|||....:|:.     |..:||||
  Fly   398 CQNDVILSGYRVPKGTTVLLGSNVLMKEATYYPRPDEFLPERWLRDPETGKKMQVSPFTFLPFGF 462

Human   446 GMRQCLGRRLAEAEMLLLLHHVLKHFLVETLTQEDIKMVYSFILRPGTSPLLTF 499
            |.|.|:|:|:.:.||...:..::::|.||............|::.|.    :||
  Fly   463 GPRMCIGKRVVDLEMETTVAKLIRNFHVEFNRDASRPFKTMFVMEPA----ITF 512

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP11B2NP_000489.3 p450 42..454 CDD:365848 103/397 (26%)
Cyp12d1-pNP_001286304.1 p450 70..508 CDD:299894 110/434 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0159
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D185685at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.