DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP11A1 and Cyp12a5

DIOPT Version :9

Sequence 1:NP_000772.2 Gene:CYP11A1 / 1583 HGNCID:2590 Length:521 Species:Homo sapiens
Sequence 2:NP_650782.1 Gene:Cyp12a5 / 42293 FlyBaseID:FBgn0038680 Length:536 Species:Drosophila melanogaster


Alignment Length:526 Identity:142/526 - (26%)
Similarity:237/526 - (45%) Gaps:70/526 - (13%)


- Green bases have known domain annotations that are detailed below.


Human    32 VPTGEGAGISTRSP-----RPFNEIPSPGDNGWLNLYHFWRET----GTHKVHLHHVQNF----Q 83
            |||.|    ....|     :||.|||.      .|:...:.::    |.:| :|..::..    |
  Fly    30 VPTAE----IRNDPEWLQAKPFEEIPK------ANILSLFAKSALPGGKYK-NLEMMEMIDALRQ 83

Human    84 KYGPI--YREKLGNVESVYVIDPEDVALLFKSEGPNPERFLIPPW---VAYHQ------YYQRPI 137
            .||.|  ....:|....|...:|:|..::|::||..|.|    |.   :.||:      ::....
  Fly    84 DYGNIIFLPGMMGRDGLVMTHNPKDFEVVFRNEGVWPFR----PGSDILRYHRTVYRKDFFDGVQ 144

Human   138 GVLLKKSAAWKKDRVALNQEVMAPEATKNFLPLLDAVSRDFVSVLHRRIKKAGSGNYSGDISDDL 202
            |::..:..:|...|..:|..:|.|:..:.:...:..|:::||.:: :.|:.|.:....|:..:.:
  Fly   145 GIIPSQGKSWGDFRSIVNPVLMQPKNVRLYFKKMSQVNQEFVELI-KEIRDASTQEVPGNFLETI 208

Human   203 FRFAFESITNVIFGERQGMLEEV-VNPEAQRFIDAIYQMFHTSVPMLNLPPDLFRLFRTKTWKDH 266
            .|:..||::.|...::.|:|.|. .|.||.:....:.:.|..|.. |.:.|.|:|.|:|...|..
  Fly   209 NRWTLESVSVVALDKQLGLLRESGKNSEATKLFKYLDEFFLHSAD-LEMKPSLWRYFKTPLLKKM 272

Human   267 VAAWDVIFSKADIYTQNFYWELR---QKGSVHHDY-RGILYRLLG-DSKMSFEDIKANVTEMLAG 326
            :...|.:......|.......|.   ::|.|..:: :.:|.:||. |.|::    .....:||..
  Fly   273 LRTMDSVQEVTLKYVDEAIERLEKEAKEGVVRPEHEQSVLEKLLKVDKKVA----TVMAMDMLMA 333

Human   327 GVDTTSMTLQWHLYEMARNLKVQDMLRAEVLAARHQAQGDMA-TMLQLVPLLKASIKETLRLHPI 390
            ||||||.|....|..:|:|.:.|..||.||:........:.. ..::.||.|:|.|||:.|::|:
  Fly   334 GVDTTSSTFTALLLCLAKNPEKQARLREEVMKVLPNKDSEFTEASMKNVPYLRACIKESQRVYPL 398

Human   391 SVTLQRYLVNDLVLRDYMIPAKTLV-QVAIYALGREPTFFFDPENFDPTRWLS------------ 442
            .:...|.|..|.|:..|.:||.|:| .:.|.:|..| .:|..|..|.|.|||.            
  Fly   399 VIGNARGLTRDSVISGYRVPAGTIVSMIPINSLYSE-EYFPKPTEFLPERWLRNASDSAGKCPAN 462

Human   443 --KDKNITYFRNLGFGWGVRQCLGRRIAELEMTIFLINMLENFRVEIQHLSDVGTTFNLILMPEK 505
              |.||...|  |.||:|.|.|:|:||.|:|:.:....::.||.||..|.:.......||.:|..
  Fly   463 DLKTKNPFVF--LPFGFGPRMCVGKRIVEMELELGTARLIRNFNVEFNHSTKNAFRSALINLPNI 525

Human   506 PISFTF 511
            |:.|.|
  Fly   526 PLKFKF 531

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP11A1NP_000772.2 p450 52..511 CDD:278495 132/499 (26%)
Cyp12a5NP_650782.1 p450 81..531 CDD:278495 127/462 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0159
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D185685at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8467
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.