DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP11A1 and Cyp12b2

DIOPT Version :9

Sequence 1:NP_000772.2 Gene:CYP11A1 / 1583 HGNCID:2590 Length:521 Species:Homo sapiens
Sequence 2:NP_611370.2 Gene:Cyp12b2 / 37163 FlyBaseID:FBgn0034387 Length:535 Species:Drosophila melanogaster


Alignment Length:496 Identity:139/496 - (28%)
Similarity:225/496 - (45%) Gaps:66/496 - (13%)


- Green bases have known domain annotations that are detailed below.


Human    46 RPFNEIPSPGDNGWLNLYHFWRETG----THKVHLHHVQNFQKYGPIY--REKLGNVESVYVIDP 104
            |.|.|||.|   ..|.:..|:...|    |:.:.::.:.. :.||.||  ...:|...:|:..:|
  Fly    51 RSFGEIPGP---SLLRMLSFFMPGGALRNTNLIQMNRLMR-EMYGDIYCIPGMMGKPNAVFTYNP 111

Human   105 EDVALLFKSEGPNPERFLIPPWVAYHQYYQRPI------GVLLKKSAAWKKDRVALNQEVMAPEA 163
            :|..:.:::||..|.|..:.. :.|::...||.      |:...:...|...|..:|..:|..:.
  Fly   112 DDFEMTYRNEGVWPIRIGLES-LNYYRKIHRPDVFKGVGGLASDQGQEWADIRNKVNPVLMKVQN 175

Human   164 TKNFLPLLDAVSRDFVSVLHRRIKKAGSGNYSGDISDDLFRFAFESITNVIFGERQGMLEEVVNP 228
            .:..||.||.:|::|:..|..: :...:...:.|..:.|..:|||||:.|....|.|:|.:..:|
  Fly   176 VRQNLPQLDQISKEFIDKLETQ-RNPETHTLTTDFHNQLKMWAFESISFVALNTRMGLLSDNPDP 239

Human   229 EAQRFIDAIYQMFHTSVPMLNLPPDLFRLFRTKTWKDHVAAWDVIFSKADIYTQNFYWELRQKGS 293
            .|.|....:...|:.|. ..::.|.::..::|..:|..:..:|.|   .|| |.| |.|...:|.
  Fly   240 NADRLAKHMRDFFNYSF-QFDVQPSIWTFYKTAGFKKFLKTYDNI---TDI-TSN-YIETAMRGF 298

Human   294 VHHD---YRGILYRLLGDSKMSFEDIKANVT---EMLAGGVDTTSMTLQWHLYEMARNLKVQDML 352
            ..:|   .:.:|.:||..:|      |..||   :||..|:||||......||.:|||...|:.|
  Fly   299 GKNDDGKTKCVLEQLLEHNK------KVAVTMVMDMLMAGIDTTSSACLTILYHLARNPSKQEKL 357

Human   353 RAE---VLAARHQAQGDMATMLQLVPLLKASIKETLRLHPISVTLQRYLVNDLVLRDYMIPAKTL 414
            |.|   :|.....:..|..|  :.:|.|:|.|||.||:..|:....|....||||..|.:|..|.
  Fly   358 RRELLRILPTTKDSLTDQNT--KNMPYLRACIKEGLRITSITPGNFRITPKDLVLSGYQVPRGTG 420

Human   415 VQVAIYALGREPTFFFDPENFDPTRWLSKD-----------KNITYFRNLGFGWGVRQCLGRRIA 468
            |.:.:..|..:..:|.....|.|.|||..|           :....|..|.||:|.|.|:|:|||
  Fly   421 VLMGVLELSNDDKYFAQSSEFIPERWLKSDLAPDIQACPAARTRNPFVYLPFGFGPRTCIGKRIA 485

Human   469 ELEMTIFLINMLENFRVEIQHLSDVGTTFNLILMPEKPISF 509
            |||:...|:.:|.:::|.              .:||.||.:
  Fly   486 ELEIETLLVRLLRSYKVS--------------WLPETPIEY 512

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP11A1NP_000772.2 p450 52..511 CDD:278495 135/490 (28%)
Cyp12b2NP_611370.2 p450 59..511 CDD:299894 133/485 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0159
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D185685at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8467
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.