DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP7A1 and Cyp9b2

DIOPT Version :9

Sequence 1:NP_000771.2 Gene:CYP7A1 / 1581 HGNCID:2651 Length:504 Species:Homo sapiens
Sequence 2:NP_523646.1 Gene:Cyp9b2 / 35635 FlyBaseID:FBgn0015039 Length:505 Species:Drosophila melanogaster


Alignment Length:513 Identity:115/513 - (22%)
Similarity:205/513 - (39%) Gaps:94/513 - (18%)


- Green bases have known domain annotations that are detailed below.


Human    10 IAIAACCCLWLILGI--------------RRRQTGEPPLENGLIPYLG----CALQFGANPLEFL 56
            :|:...|...:::|.              .|:...|.|     .|::|    .|||..:...:..
  Fly     1 MALIEICLALVVIGYLIYKWSTATFKTFEERKLYFEKP-----YPFVGNMAAAALQKSSFQRQLT 60

Human    57 RANQRKHGHVFTCKLMGKY---VHFIT-NPLSYHKVLCHGKYFDWKKFH--FATSAKAFGHRSID 115
            ...:|...|    ||:|.:   ...|| |.....|.:| .|.||....|  |.||.....:..:.
  Fly    61 EFYERTRQH----KLVGFFNMRTPMITLNDPELIKKVC-VKDFDHFPNHQPFITSNDRLFNDMLS 120

Human   116 PMDGNTTENINDT----FIKTLQGHALNSLTESMMENLQRIMRPPVSSNSKTAAWVTEGMYSF-- 174
            .|.....:::.:|    |......:....:.||..|.||.:     .|:|||    ..|...|  
  Fly   121 VMRDQRWKHMRNTLTPVFTAAKMRNMFTLMNESFAECLQHL-----DSSSKT----LPGRKGFEV 176

Human   175 -----CYRVMFEAGYLTIFGRDLTRRDTQKAHIL---------NNLDNFK-QFDKVFPALVAGLP 224
                 |.::..:....|.||..:...|..|....         ..|..|| ....:.|.|.:.|.
  Fly   177 DMKVMCNKLSNDIIATTAFGLKVNSYDNPKNEFYEIGQSLVFSRGLQFFKFMLSTLVPKLFSLLK 241

Human   225 IHMFRTA---HNAREKLAESLRH---ENLQKRESISELISLRMFLNDTLSTFDDLEKAKTHLVVL 283
            :.:|.:|   :.|| .:.|::::   .|:.:.:.|..|:..:   |::...:.|.|......:..
  Fly   242 LTIFDSAKVDYFAR-LVVEAMQYREKHNITRPDMIQLLMEAK---NESEDKWTDDEIVAQCFIFF 302

Human   284 WASQANTIPATFWSLFQMIRNPEAMKAATEEVKRTLENAGQKVSLEGNPICLSQAELNDLPVLDS 348
            :|:..|.......:.::::.||:..:...||:..|      |.:|.|.|  |:...:..:..:|.
  Fly   303 FAAFENNSNLICTTTYELLYNPDVQERLYEEIVET------KKALNGAP--LTYDAVQKMTYMDM 359

Human   349 IIKESLR-LSSASLNIRTAKEDFTLHLEDGS--YNIRKDDIIALYPQLMHLDPEIYPDPLTFKYD 410
            :|.|||| .:.|:...|...:|:||..:||:  ::.:..|.|.:....:|||...:|:|..|..|
  Fly   360 VISESLRKWTLAAATDRLCSKDYTLTDDDGTKLFDFKVGDRINIPISGLHLDDRYFPEPRKFDPD 424

Human   411 RYLDENGKTKTTFYCNGLKLKYYYMPFGSGATICPGRLFAIHEIKQFLILMLSYFELE 468
            |:.:|.         .|..:.|.|:|||.|...|.|..:|:.::|..|..:|.::::|
  Fly   425 RFSEER---------KGDMVPYTYLPFGVGPRNCIGNRYALMQVKGMLFNLLLHYKIE 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP7A1NP_000771.2 p450 32..497 CDD:365848 110/477 (23%)
Cyp9b2NP_523646.1 p450 37..478 CDD:299894 110/477 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5364
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.