DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP7A1 and Cyp28d2

DIOPT Version :9

Sequence 1:NP_000771.2 Gene:CYP7A1 / 1581 HGNCID:2651 Length:504 Species:Homo sapiens
Sequence 2:NP_608911.1 Gene:Cyp28d2 / 33748 FlyBaseID:FBgn0031688 Length:501 Species:Drosophila melanogaster


Alignment Length:477 Identity:103/477 - (21%)
Similarity:187/477 - (39%) Gaps:154/477 - (32%)


- Green bases have known domain annotations that are detailed below.


Human    66 VFTCK------LMGKYVH--FITNPLSYHKVLCHGKYFDWKKFHFATSAKAFGHRSIDPMDGNTT 122
            |||.:      :..:|:|  :.|:..|:|.       .:|:.         |.::..|.:.|   
  Fly    76 VFTTRVPQLLVMCPEYIHKIYATDFRSFHN-------NEWRN---------FVNKKTDMILG--- 121

Human   123 ENINDTFIKTLQGHALNSLTESMMENLQRIMRPPVSSNSKTAAW--------------------- 166
               |:.|:.|         .:...|....|| |.:|.|...|.:                     
  Fly   122 ---NNPFVLT---------GDEWKERRSEIM-PALSPNRVKAVYPVSQSVCKKFVEYIRRQQQMA 173

Human   167 VTEGM----YSFCY--RVMFEAGYLTIFGRDLTRRDTQKAHILNNLDNFKQFDKVFPALVAGL-- 223
            .:||:    .|.||  .|:.:.| |.:..:..|...|....::..:.| ..|:.:|.::|..|  
  Fly   174 TSEGLDAMDLSLCYTTEVVSDCG-LGVSAQSFTDTPTPLLKMIKRVFN-TSFEFIFYSVVTNLWQ 236

Human   224 --------P----------IHMFRTAHNAREKLAESLRHE------NLQKRESI---SELISLRM 261
                    |          :.:.|.....|.:..|..|.:      .||:::.:   :.||:...
  Fly   237 KVRKFYSVPFFNKETEVFFLDIIRRCITLRLEKPEQQRDDFLNYMLQLQEKKGLHTDNILINTMT 301

Human   262 FLNDTLSTFDDLEKAKTHLVVLWASQANTIPATFWSLFQMIRNPEAMKAATEEVKRTLENAGQKV 326
            |:   |..|:.......|::::                 :.||||..    ::|::.:.:|.   
  Fly   302 FI---LDGFETTALVLAHIMLM-----------------LGRNPEEQ----DKVRKEIGSAD--- 339

Human   327 SLEGNPICLSQAELNDLPVLDSIIKESLRLSSASLNIR---------TAKEDFTLHLEDGSYNIR 382
                    |:..::::||.||:.|.|:|||.|..:..|         ..|...|:||:.|     
  Fly   340 --------LTFDQMSELPHLDACIYETLRLFSPQVAARKLVTEPFEFANKNGRTVHLKPG----- 391

Human   383 KDDIIALYPQLMHLDPEIYPDPLTFKYDRYLDENGKTKTTFYCNGLKLKYYYMPFGSGATICPGR 447
              |::.:..:.:|.||:.|.||||||.:|:|:.||....::...|:     |:.||.|...|||.
  Fly   392 --DVVTIPVKALHHDPQYYEDPLTFKPERFLESNGGGMKSYRDRGV-----YLAFGDGPRHCPGM 449

Human   448 LFAIHEIKQFLILMLSYFELEL 469
            .||:.::|..|:.:|..||:::
  Fly   450 RFALTQLKAALVEILRNFEIKV 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP7A1NP_000771.2 p450 32..497 CDD:365848 103/477 (22%)
Cyp28d2NP_608911.1 p450 38..475 CDD:299894 103/477 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5364
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.